close

SimulationCraft 815-02

for World of Warcraft 8.2.0 PTR (wow build level 30329)

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2019-05-15 Real Procs Per Minute data removed from Killing Machine.
Killing Machine rppm 4.50 0.00
2019-03-12 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2018-05-02 Incorrect spell level for Icicle buff.
Icicles spell_level 78.00 80.00
2017-11-08 Incorrect spell level for Ignite.
Ignite spell_level 78.00 99.00
2017-11-06 Incorrect spell level for Icicle.
Icicle spell_level 78.00 80.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2019-01-07 Incorrect Maelstrom generation value for Chain Lightning Overloads.
Fulmination (effect#6) base_value 2.00 3.00

The Crucible of Flame

Tag Spell / Effect Field Hotfixed Value DBC Value
2019-06-23 Correct Ancient Flame rank 2 upgrade.
Ancient Flame (effect#1) base_value 35.00 25.00
2019-06-23 Correct Ancient Flame base damage.
Ancient Flame (effect#3) coefficient 1.23 2.28

Table of Contents

Raid Summary

 

Created with Highcharts 4.2.3 Damage per Second39,677 (12.42%)39,605 (12.22%)39,304 (11.37%)38,027 (7.75%)37,551 (6.40%)37,167 (5.31%)36,715 (4.03%)36,693 (3.97%)36,685 (3.95%)36,224 (2.64%)36,005 (2.02%)35,292conflict+strifevisionslife-forcelucid dreamsblood of the enemycrucible of flameworldveinunbound forcefocusing irisripple in spacepurification protocolbasefocusing iris Damage per Second: 36,685.0

Actions per Minute / DPS Variance Summary

base : 35292 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
35292.2 35292.2 25.2 / 0.072% 4301.1 / 12.2% 4285.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.2 8.1 Astral Power 0.00% 58.0 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
base 35292
Heed My Call 292 (417) 0.8% (1.2%) 8.2 33.35sec 15336 0 Direct 8.2 9106 18221 10730 17.8%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.16 8.16 0.00 0.00 0.0000 0.0000 87515.76 87515.76 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.70 82.18% 9106.27 8901 9791 9107.31 8901 9791 61033 61033 0.00
crit 1.45 17.82% 18220.98 17802 19582 14072.48 0 19582 26483 26483 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 125 0.4% 8.2 33.35sec 4606 0 Direct 8.2 3902 7811 4606 18.0%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.16 8.16 0.00 0.00 0.0000 0.0000 37564.78 37564.78 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.69 82.00% 3902.45 3815 4196 3901.23 0 4196 26099 26099 0.00
crit 1.47 18.00% 7811.14 7629 8392 6060.50 0 8392 11466 11466 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5069 14.4% 77.8 3.77sec 19534 14898 Direct 77.8 16571 33115 19535 17.9%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.75 77.75 0.00 0.00 1.3112 0.0000 1518797.54 1518797.54 0.00 14898.50 14898.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.82 82.09% 16570.70 8882 21253 16578.49 15970 17418 1057581 1057581 0.00
crit 13.93 17.91% 33115.15 17765 42507 33129.40 28710 37980 461217 461217 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2456 7.0% 14.1 21.40sec 52324 51668 Direct 14.1 2860 5719 3370 17.8%  
Periodic 221.9 2629 5256 3102 18.0% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.06 14.06 221.85 221.85 1.0128 1.3420 735543.84 735543.84 0.00 2357.84 51667.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.55 82.15% 2859.59 2589 3565 2861.62 2637 3192 33025 33025 0.00
crit 2.51 17.85% 5719.38 5177 7129 5348.51 0 7129 14348 14348 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.9 82.01% 2629.49 2 3319 2630.77 2559 2754 478429 478429 0.00
crit 39.9 17.99% 5256.19 34 6638 5258.46 4863 5677 209742 209742 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 795 2.3% 44.2 6.67sec 5385 0 Direct 44.2 4564 9121 5385 18.0%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.21 44.21 0.00 0.00 0.0000 0.0000 238036.46 238036.46 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.25 81.99% 4563.97 4180 5756 4566.08 4310 5045 165424 165424 0.00
crit 7.96 18.01% 9121.00 8360 11513 9118.48 0 11092 72612 72612 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2850 (4497) 8.1% (12.8%) 94.4 3.12sec 14274 15778 Direct 94.9 7633 15252 8996 17.9%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.36 94.88 0.00 0.00 0.9047 0.0000 853572.52 853572.52 0.00 15777.65 15777.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.91 82.11% 7633.15 6967 9594 7638.01 7363 8007 594675 594675 0.00
crit 16.98 17.89% 15251.55 13933 19188 15260.28 14072 17397 258898 258898 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1647 4.7% 74.8 3.93sec 6596 0 Direct 74.8 6596 0 6596 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.79 74.79 0.00 0.00 0.0000 0.0000 493302.15 493302.15 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.79 100.00% 6595.90 5086 14007 6599.54 5729 7619 493302 493302 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5594.17
  • base_dd_max:5594.17
  • base_dd_mult:1.00
 
Starsurge 11905 33.8% 61.6 4.92sec 57851 54922 Direct 61.4 49241 98386 58036 17.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.61 61.42 0.00 0.00 1.0533 0.0000 3564384.66 3564384.66 0.00 54922.03 54922.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.43 82.10% 49241.12 45067 61614 49263.50 47308 51431 2483027 2483027 0.00
crit 10.99 17.90% 98386.06 90135 123227 98441.65 90135 114954 1081357 1081357 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1594 4.5% 12.8 23.57sec 37357 36276 Direct 12.8 2424 4841 2855 17.9%  
Periodic 219.5 1704 3406 2009 17.9% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.78 12.78 219.51 219.51 1.0298 1.3447 477571.55 477571.55 0.00 1548.91 36275.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.50 82.15% 2423.69 2231 3073 2424.22 2253 2642 25452 25452 0.00
crit 2.28 17.85% 4840.86 4463 6146 4438.72 0 6146 11050 11050 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.1 82.07% 1704.06 4 2151 1704.89 1657 1778 306972 306972 0.00
crit 39.4 17.93% 3406.49 27 4302 3408.05 3157 3686 134098 134098 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5828 16.4% 90.1 3.10sec 19274 0 Direct 90.1 16348 32705 19274 17.9%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.09 90.09 0.00 0.00 0.0000 0.0000 1736309.05 1736309.05 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.97 82.11% 16347.63 15985 17583 16347.85 15985 17235 1209246 1209246 0.00
crit 16.12 17.89% 32705.03 31970 35167 32704.08 31970 34938 527063 527063 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2732 7.7% 17.9 16.77sec 45819 44656 Direct 17.9 3914 7825 4619 18.0%  
Periodic 221.0 2824 5646 3330 17.9% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.86 17.86 220.97 220.97 1.0261 1.3432 818403.77 818403.77 0.00 2597.00 44655.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.64 81.97% 3914.18 3570 4917 3915.18 3642 4338 57307 57307 0.00
crit 3.22 18.03% 7824.62 7141 9834 7597.96 0 9834 25203 25203 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.3 82.07% 2824.36 4 3565 2825.76 2744 2948 512190 512190 0.00
crit 39.6 17.93% 5646.07 23 7129 5648.57 5286 6162 223705 223705 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
base
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:base
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.65sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.62sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9095 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:base
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:base
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.2 54.2 44.0sec 4.9sec 93.19% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.86%
  • arcanic_pulsar_2:10.29%
  • arcanic_pulsar_3:11.31%
  • arcanic_pulsar_4:10.56%
  • arcanic_pulsar_5:13.76%
  • arcanic_pulsar_6:10.56%
  • arcanic_pulsar_7:10.73%
  • arcanic_pulsar_8:14.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.7sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:base
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.7sec 182.7sec 8.11% 7.55% 0.0(0.0) 2.0

Buff details

  • buff initial source:base
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:base
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.3 0.0 37.4sec 37.4sec 25.98% 32.53% 0.0(0.0) 8.1

Buff details

  • buff initial source:base
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.1 61.1sec 45.9sec 23.67% 0.00% 1.1(1.1) 4.1

Buff details

  • buff initial source:base
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.23% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:base
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.95%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.84%
  • ignition_mages_fuse_4:3.80%
  • ignition_mages_fuse_5:3.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 34.4 46.3 8.8sec 3.7sec 82.33% 99.73% 1.9(1.9) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.00%
  • lunar_empowerment_2:32.02%
  • lunar_empowerment_3:14.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.5 3.4 64.8sec 34.1sec 47.51% 0.00% 3.4(47.8) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.44%
  • overwhelming_power_4:1.48%
  • overwhelming_power_5:1.52%
  • overwhelming_power_6:1.56%
  • overwhelming_power_7:1.61%
  • overwhelming_power_8:1.65%
  • overwhelming_power_9:1.70%
  • overwhelming_power_10:1.75%
  • overwhelming_power_11:1.80%
  • overwhelming_power_12:1.85%
  • overwhelming_power_13:1.91%
  • overwhelming_power_14:1.96%
  • overwhelming_power_15:2.02%
  • overwhelming_power_16:2.08%
  • overwhelming_power_17:2.14%
  • overwhelming_power_18:2.20%
  • overwhelming_power_19:2.27%
  • overwhelming_power_20:2.34%
  • overwhelming_power_21:2.42%
  • overwhelming_power_22:2.49%
  • overwhelming_power_23:2.57%
  • overwhelming_power_24:2.63%
  • overwhelming_power_25:1.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 25.0 52.1 11.9sec 3.9sec 85.71% 78.94% 0.2(0.2) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.23%
  • solar_empowerment_2:39.83%
  • solar_empowerment_3:17.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 46.3 20.2sec 4.9sec 97.82% 92.77% 16.1(16.1) 11.5

Buff details

  • buff initial source:base
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.12%
  • starlord_2:22.60%
  • starlord_3:61.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.4sec 45.9sec 23.54% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:base
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.54%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
base
starsurge Astral Power 61.6 2464.5 40.0 40.0 1446.3
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 95.36 762.81 (31.43%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.30%) 40.00 0.00 0.00%
sunfire Astral Power 17.86 53.58 (2.21%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.21 176.82 (7.29%) 4.00 0.00 0.00%
moonfire Astral Power 14.06 42.17 (1.74%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.78 102.27 (4.21%) 8.00 0.00 0.00%
lunar_strike Astral Power 77.75 932.93 (38.44%) 12.00 0.07 0.01%
natures_balance Astral Power 400.43 200.21 (8.25%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.34 76.03 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.09 8.22
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.62 0.00 59.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data base Fight Length
Count 7600
Mean 299.94
Minimum 240.00
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data base Damage Per Second
Count 7600
Mean 35292.23
Minimum 31626.03
Maximum 39693.20
Spread ( max - min ) 8067.18
Range [ ( max - min ) / 2 * 100% ] 11.43%
Standard Deviation 1122.9831
5th Percentile 33529.39
95th Percentile 37208.55
( 95th Percentile - 5th Percentile ) 3679.16
Mean Distribution
Standard Deviation 12.8815
95.00% Confidence Intervall ( 35266.98 - 35317.48 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3890
0.1 Scale Factor Error with Delta=300 10766
0.05 Scale Factor Error with Delta=300 43062
0.01 Scale Factor Error with Delta=300 1076540
Priority Target DPS
Sample Data base Priority Target Damage Per Second
Count 7600
Mean 35292.23
Minimum 31626.03
Maximum 39693.20
Spread ( max - min ) 8067.18
Range [ ( max - min ) / 2 * 100% ] 11.43%
Standard Deviation 1122.9831
5th Percentile 33529.39
95th Percentile 37208.55
( 95th Percentile - 5th Percentile ) 3679.16
Mean Distribution
Standard Deviation 12.8815
95.00% Confidence Intervall ( 35266.98 - 35317.48 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3890
0.1 Scale Factor Error with Delta=300 10766
0.05 Scale Factor Error with Delta=300 43062
0.01 Scale Factor Error with Delta=300 1076540
DPS(e)
Sample Data base Damage Per Second (Effective)
Count 7600
Mean 35292.23
Minimum 31626.03
Maximum 39693.20
Spread ( max - min ) 8067.18
Range [ ( max - min ) / 2 * 100% ] 11.43%
Damage
Sample Data base Damage
Count 7600
Mean 10561002.08
Minimum 8323195.63
Maximum 13186667.33
Spread ( max - min ) 4863471.70
Range [ ( max - min ) / 2 * 100% ] 23.03%
DTPS
Sample Data base Damage Taken Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data base Healing Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data base Healing Per Second (Effective)
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data base Heal
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data base Healing Taken Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data base Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data baseTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data base Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 thorns
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
I 2.86 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
J 61.61 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
K 2.88 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
L 3.08 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
M 14.76 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
N 10.98 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 12.78 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 78.12 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 94.62 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.22 sunfire

Sample Sequence

0123456789ACDJNMOHFGJQPJQPJQPJQPQMQPNQPIJQJOQPJPPQQQQQQJQJMQPQPIJJNPPJQOPQJQPMPQPQQJJNPPQJPQMOQQQQQIJQJQPJLPJMPQPJQOPPJQPQJPPMNJQPQQQQQQJJOQPJQGKPNPJQPPQPQQQJJPMOQJQPPJNQPQQQQPJJMQPJOQPQJLPQPMQPJQPQJHEFQJOQPJNQPMQIJQPJQPJQPPPQQJQOQRIJLJPPJQPJQPQPMQQQQJJNOPQJGQPPMQJQPQQQJQJQPJQLP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask base 58.0/100: 58% astral_power
Pre precombat 1 food base 58.0/100: 58% astral_power
Pre precombat 2 augmentation base 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.248 default N moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.182 default M sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.116 default O stellar_flare Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.049 default H celestial_alignment Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.862 default F berserking Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.862 default G use_items Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.862 default J starsurge Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:05.617 default Q solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:06.373 default P lunar_strike Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.250 default J starsurge Fluffy_Pillow 72.5/100: 73% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.004 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.758 default P lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.612 default J starsurge Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.367 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.121 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.941 default J starsurge Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(25), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.695 default Q solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.450 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.203 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.959 default M sunfire Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.712 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.467 default P lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.224 default N moonfire Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.978 default Q solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.732 default P lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(18), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.523 default I cancel_buff Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, starlord(3), overwhelming_power(17), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.523 default J starsurge Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, overwhelming_power(17), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.277 default Q solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(16), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.032 default J starsurge Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord, overwhelming_power(15), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.786 default O stellar_flare Fluffy_Pillow 20.5/100: 21% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(15), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.542 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(14), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.297 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(13), conch_of_dark_whispers, ignition_mages_fuse(5)
0:24.094 default J starsurge Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(12), conch_of_dark_whispers, ignition_mages_fuse(5)
0:24.847 default P lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(12), conch_of_dark_whispers, ignition_mages_fuse(5)
0:25.740 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(11), conch_of_dark_whispers
0:26.819 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(10), conch_of_dark_whispers
0:27.574 default Q solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(9), conch_of_dark_whispers
0:28.329 default Q solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(8), conch_of_dark_whispers
0:29.184 default Q solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(7), conch_of_dark_whispers
0:30.043 default Q solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(6), conch_of_dark_whispers
0:30.905 default Q solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(6), conch_of_dark_whispers
0:31.766 default J starsurge Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25)
0:32.571 default Q solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24)
0:33.326 default J starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23)
0:34.082 default M sunfire Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22)
0:34.837 default Q solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22)
0:35.593 default P lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(25)
0:36.486 default Q solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24)
0:37.241 default P lunar_strike Fluffy_Pillow 77.5/100: 78% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23)
0:38.142 default I cancel_buff Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22)
0:38.142 default J starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, torrent_of_elements, overwhelming_power(22)
0:38.916 default J starsurge Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(22)
0:39.777 default N moonfire Fluffy_Pillow 11.5/100: 12% astral_power bloodlust, arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(21)
0:40.617 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power bloodlust, arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(20)
0:41.693 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(19)
0:43.092 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(17)
0:44.200 default Q solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(16)
0:45.118 default O stellar_flare Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(15)
0:46.201 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(14)
0:47.587 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(13)
0:48.514 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12)
0:49.611 default Q solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(11)
0:50.549 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(10), conch_of_dark_whispers
0:51.956 default M sunfire Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(9), conch_of_dark_whispers
0:53.063 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(7), conch_of_dark_whispers
0:54.483 default Q solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(24), conch_of_dark_whispers
0:55.377 default P lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(23), conch_of_dark_whispers
0:56.720 default Q solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(22), conch_of_dark_whispers
0:57.621 default Q solar_wrath Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(21), conch_of_dark_whispers
0:58.682 default J starsurge Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(5), overwhelming_power(20), conch_of_dark_whispers
0:59.841 default J starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(19), conch_of_dark_whispers
1:00.973 default N moonfire Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(18), conch_of_dark_whispers
1:02.077 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(16), conch_of_dark_whispers
1:03.493 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(15), conch_of_dark_whispers
1:04.914 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power(14), conch_of_dark_whispers
1:05.864 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2), overwhelming_power(13), conch_of_dark_whispers
1:06.986 default P lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12), conch_of_dark_whispers
1:08.384 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(10), conch_of_dark_whispers
1:09.324 default M sunfire Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(9), conch_of_dark_whispers
1:10.432 default O stellar_flare Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(8), conch_of_dark_whispers
1:11.545 default Q solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(7), conch_of_dark_whispers
1:12.494 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(6), conch_of_dark_whispers
1:13.613 default Q solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(5), conch_of_dark_whispers
1:14.738 default Q solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(4), conch_of_dark_whispers
1:15.866 default Q solar_wrath Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(3), conch_of_dark_whispers
1:17.000 default I cancel_buff Fluffy_Pillow 92.0/100: 92% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power, conch_of_dark_whispers
1:17.000 default J starsurge Fluffy_Pillow 92.0/100: 92% astral_power arcanic_pulsar(8), torrent_of_elements, overwhelming_power, conch_of_dark_whispers
1:18.243 default Q solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers
1:19.140 default J starsurge Fluffy_Pillow 81.5/100: 82% astral_power celestial_alignment, lunar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers
1:20.194 default Q solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements
1:21.066 default P lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements
1:22.372 default J starsurge Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements
1:23.397 default L moonfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements
1:24.394 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements
1:25.853 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements
1:26.998 default M sunfire Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(25)
1:28.045 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23)
1:29.389 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(22)
1:30.290 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21)
1:31.643 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20)
1:32.708 default Q solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(19)
1:33.616 default O stellar_flare Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18)
1:34.689 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(17)
1:36.060 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15)
1:37.442 default J starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(4), solar_empowerment(2), overwhelming_power(14)
1:38.628 default Q solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(25)
1:39.569 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(24)
1:40.984 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, overwhelming_power(23)
1:41.932 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(22)
1:43.052 default P lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(20)
1:44.448 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(19)
1:45.847 default M sunfire Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(18)
1:46.948 default N moonfire Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(17)
1:48.057 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(15)
1:49.172 default Q solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(14)
1:50.098 default P lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(13)
1:51.489 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(12)
1:52.421 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(11)
1:53.358 default Q solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(10)
1:54.463 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(9)
1:55.571 default Q solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(8)
1:56.682 default Q solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(25)
1:57.729 default J starsurge Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(7), lunar_empowerment, overwhelming_power(24)
1:58.873 default J starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(23)
1:59.988 default O stellar_flare Fluffy_Pillow 12.5/100: 13% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(22)
2:00.935 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(21)
2:01.744 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(20)
2:02.957 default J starsurge Fluffy_Pillow 42.5/100: 43% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(19)
2:03.913 default Q solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(18)
2:04.707 default G use_items Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(17)
2:04.707 default K sunfire Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(17), ignition_mages_fuse
2:05.607 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(16), ignition_mages_fuse
2:06.932 default N moonfire Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(15), ignition_mages_fuse
2:07.973 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(14), ignition_mages_fuse
2:09.306 default J starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12), ignition_mages_fuse(2)
2:10.319 default Q solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(11), ignition_mages_fuse(2)
2:11.184 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(10), ignition_mages_fuse(2)
2:12.486 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(9), ignition_mages_fuse(2)
2:13.791 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(8), ignition_mages_fuse(3)
2:14.632 default P lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(7), ignition_mages_fuse(3)
2:15.897 default Q solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(6), ignition_mages_fuse(3)
2:16.745 default Q solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(5), ignition_mages_fuse(4)
2:17.567 default Q solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(4), ignition_mages_fuse(4)
2:18.536 default J starsurge Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar(2), overwhelming_power(3), ignition_mages_fuse(4)
2:19.593 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(2), ignition_mages_fuse(4)
2:20.622 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power, ignition_mages_fuse(4)
2:21.900 default M sunfire Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), ignition_mages_fuse(5)
2:22.873 default O stellar_flare Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, ignition_mages_fuse(5)
2:23.846 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, ignition_mages_fuse(5)
2:24.672 default J starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, ignition_mages_fuse(5)
2:25.646 default Q solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
2:26.621 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
2:28.079 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
2:29.540 default J starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements
2:30.685 default N moonfire Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
2:31.830 default Q solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
2:32.804 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
2:34.263 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), torrent_of_elements
2:35.237 default Q solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements
2:36.210 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements
2:37.182 default Q solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements
2:38.327 default P lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3)
2:39.787 default J starsurge Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar(6), solar_empowerment
2:41.035 default J starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord
2:42.247 default M sunfire Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2)
2:43.423 default Q solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2)
2:44.425 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2)
2:45.924 default J starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2)
2:47.102 default O stellar_flare Fluffy_Pillow 15.0/100: 15% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3)
2:48.099 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3)
2:48.948 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3)
2:50.217 default Q solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
2:51.064 default J starsurge Fluffy_Pillow 54.0/100: 54% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
2:52.062 default L moonfire Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements
2:53.059 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements
2:54.518 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
2:55.492 default P lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:56.952 default M sunfire Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:58.098 default Q solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:59.072 default P lunar_strike Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
3:00.531 default J starsurge Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), torrent_of_elements, conch_of_dark_whispers
3:01.780 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord, torrent_of_elements, conch_of_dark_whispers
3:02.811 default P lunar_strike Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers
3:04.355 default Q solar_wrath Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, conch_of_dark_whispers
3:05.385 default J starsurge Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers
3:06.597 default H celestial_alignment Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), conch_of_dark_whispers
3:07.623 default E potion Fluffy_Pillow 87.0/100: 87% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), conch_of_dark_whispers
3:07.623 default F berserking Fluffy_Pillow 87.0/100: 87% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:07.623 default Q solar_wrath Fluffy_Pillow 87.0/100: 87% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:08.414 default J starsurge Fluffy_Pillow 95.5/100: 96% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:09.347 default O stellar_flare Fluffy_Pillow 56.0/100: 56% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:10.253 default Q solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:11.023 default P lunar_strike Fluffy_Pillow 77.0/100: 77% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:12.177 default J starsurge Fluffy_Pillow 90.0/100: 90% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:13.084 default N moonfire Fluffy_Pillow 50.5/100: 51% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect
3:13.989 default Q solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect
3:14.759 default P lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:15.912 default M sunfire Fluffy_Pillow 75.5/100: 76% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:16.818 default Q solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:17.589 default I cancel_buff Fluffy_Pillow 91.5/100: 92% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect
3:17.589 default J starsurge Fluffy_Pillow 91.5/100: 92% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, battle_potion_of_intellect
3:18.577 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord, battle_potion_of_intellect
3:19.393 default P lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, battle_potion_of_intellect
3:20.613 default J starsurge Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
3:21.665 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), battle_potion_of_intellect
3:22.537 default P lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(25), battle_potion_of_intellect
3:23.729 default J starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(24), battle_potion_of_intellect
3:24.668 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(23), battle_potion_of_intellect
3:25.447 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22), battle_potion_of_intellect
3:26.619 default P lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21), battle_potion_of_intellect
3:27.972 default P lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20), battle_potion_of_intellect
3:29.331 default Q solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18), battle_potion_of_intellect
3:30.240 default Q solar_wrath Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(17), battle_potion_of_intellect
3:31.156 default J starsurge Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(16), battle_potion_of_intellect
3:32.236 default Q solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(15), battle_potion_of_intellect
3:33.036 default O stellar_flare Fluffy_Pillow 70.0/100: 70% astral_power celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(14)
3:33.983 default Q solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(14)
3:34.931 default R sunfire Fluffy_Pillow 87.0/100: 87% astral_power celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(13)
3:35.881 default I cancel_buff Fluffy_Pillow 94.5/100: 95% astral_power celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(12)
3:35.881 default J starsurge Fluffy_Pillow 94.5/100: 95% astral_power celestial_alignment, lunar_empowerment, torrent_of_elements, overwhelming_power(12)
3:36.920 default L moonfire Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(11)
3:37.933 default J starsurge Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(10)
3:39.102 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(8)
3:40.557 default P lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(7)
3:42.019 default J starsurge Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(5)
3:43.175 default Q solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(4)
3:44.133 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(3)
3:45.575 default J starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(2)
3:46.714 default Q solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power
3:47.684 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
3:49.143 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
3:50.118 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
3:51.577 default M sunfire Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(3), torrent_of_elements
3:52.724 default Q solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(3), torrent_of_elements
3:53.700 default Q solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements
3:54.672 default Q solar_wrath Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), torrent_of_elements
3:55.646 default Q solar_wrath Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(4), starlord(3), torrent_of_elements
3:56.792 default J starsurge Fluffy_Pillow 98.5/100: 99% astral_power arcanic_pulsar(4), torrent_of_elements
3:58.039 default J starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
3:59.252 default N moonfire Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
4:00.431 default O stellar_flare Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
4:01.609 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
4:03.109 default Q solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements
4:04.111 default J starsurge Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2)
4:05.287 default G use_items Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3)
4:05.287 default Q solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), ignition_mages_fuse
4:06.222 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse
4:07.621 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse
4:09.021 default M sunfire Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(3), torrent_of_elements, ignition_mages_fuse
4:10.121 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(3), torrent_of_elements, ignition_mages_fuse(2)
4:11.019 default J starsurge Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(2)
4:12.075 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, ignition_mages_fuse(2)
4:12.973 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(2)
4:14.319 default Q solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(3)
4:15.185 default Q solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, ignition_mages_fuse(3)
4:16.050 default Q solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, ignition_mages_fuse(3)
4:17.066 default J starsurge Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(8), torrent_of_elements, ignition_mages_fuse(3)
4:18.174 default Q solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, ignition_mages_fuse(4)
4:18.943 default J starsurge Fluffy_Pillow 63.5/100: 64% astral_power celestial_alignment, lunar_empowerment, starlord, torrent_of_elements, ignition_mages_fuse(4)
4:19.845 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, ignition_mages_fuse(4)
4:20.598 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, ignition_mages_fuse(4)
4:21.715 default J starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), ignition_mages_fuse(5)
4:22.561 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(5)
4:23.314 default L moonfire Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), ignition_mages_fuse(5)
4:24.138 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), ignition_mages_fuse(5)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="base"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/thorns
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

blood of the enemy : 37551 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
37551.4 37551.4 28.7 / 0.076% 4876.4 / 13.0% 4573.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.2 8.1 Astral Power 0.00% 58.5 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
blood of the enemy 37551
Blood of the Enemy 363 1.0% 3.7 91.18sec 29512 30729 Direct 3.7 22900 57311 29510 19.2%  

Stats details: blood_of_the_enemy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.68 3.68 0.00 0.00 0.9604 0.0000 108626.84 108626.84 0.00 30728.95 30728.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.97 80.79% 22899.92 22467 24714 22842.70 0 24714 68094 68094 0.00
crit 0.71 19.21% 57310.73 56168 61785 31159.90 0 61785 40533 40533 0.00
 
 

Action details: blood_of_the_enemy

Static Values
  • id:297108
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:cooldown.ca_inc.remains>30
Spelldata
  • id:297108
  • name:Blood of the Enemy
  • school:shadow
  • tooltip:You have a $w2% increased chance to be Critically Hit by the caster.
  • description:The Heart of Azeroth erupts violently, dealing {$s1=5936} Shadow damage to enemies within $A1 yds. You gain $m2% critical strike chance against the targets for {$d=10 seconds}$?a297122[, and increases your critical hit damage by $297126m% for {$297126d=5 seconds}][].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:20460.77
  • base_dd_max:20460.77
  • base_dd_mult:1.00
 
Heed My Call 309 (441) 0.8% (1.2%) 8.2 33.02sec 16068 0 Direct 8.2 9105 18716 11241 22.2%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.23 8.23 0.00 0.00 0.0000 0.0000 92485.76 92485.76 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.40 77.78% 9105.40 8901 9791 9103.22 0 9791 58269 58269 0.00
crit 1.83 22.22% 18715.74 17802 24477 15908.38 0 24477 34217 34217 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 133 0.4% 8.2 33.02sec 4827 0 Direct 8.2 3903 8014 4827 22.5%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.23 8.23 0.00 0.00 0.0000 0.0000 39712.72 39712.72 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.38 77.53% 3902.95 3815 4196 3902.06 0 4196 24895 24895 0.00
crit 1.85 22.47% 8014.07 7629 10490 6853.92 0 10490 14817 14817 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5227 13.9% 77.3 3.79sec 20259 15585 Direct 77.3 16500 33939 20258 21.6%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.30 77.30 0.00 0.00 1.2999 0.0000 1566067.48 1566067.48 0.00 15584.93 15584.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.64 78.45% 16499.85 8882 21253 16505.80 15870 17406 1000608 1000608 0.00
crit 16.66 21.55% 33939.11 17765 53133 33974.83 30106 41597 565460 565460 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2604 6.9% 14.1 21.40sec 55450 54979 Direct 14.1 2846 5929 3517 21.8%  
Periodic 223.9 2617 5511 3261 22.3% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.06 14.06 223.86 223.86 1.0086 1.3299 779552.27 779552.27 0.00 2499.44 54979.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.00 78.23% 2845.93 2589 3565 2847.26 2621 3167 31301 31301 0.00
crit 3.06 21.77% 5929.32 5177 8912 5791.62 0 8912 18145 18145 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 174.0 77.72% 2616.60 2 3319 2617.65 2545 2748 455231 455231 0.00
crit 49.9 22.28% 5510.59 3 8297 5516.15 5064 6061 274875 274875 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 845 2.3% 44.8 6.55sec 5656 0 Direct 44.8 4542 9544 5656 22.3%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.75 44.75 0.00 0.00 0.0000 0.0000 253113.84 253113.84 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.79 77.74% 4542.02 4180 5756 4543.67 4271 4950 158020 158020 0.00
crit 9.96 22.26% 9544.45 8360 14391 9552.18 8360 14391 95094 95094 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2956 (4678) 7.9% (12.5%) 93.8 3.13sec 14937 16627 Direct 94.3 7589 15693 9389 22.2%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.78 94.28 0.00 0.00 0.8984 0.0000 885174.59 885174.59 0.00 16626.62 16626.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.34 77.79% 7589.17 6967 9594 7592.89 7348 7982 556572 556572 0.00
crit 20.94 22.21% 15692.57 13933 23984 15709.01 14250 18598 328603 328603 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1722 4.6% 74.5 3.93sec 6925 0 Direct 74.5 6925 0 6925 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.45 74.45 0.00 0.00 0.0000 0.0000 515601.51 515601.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.45 100.00% 6925.13 5086 17509 6931.25 5878 8214 515602 515602 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11188.33
  • base_dd_max:11188.33
  • base_dd_mult:1.00
 
Starsurge 12556 33.5% 61.4 4.92sec 61204 58589 Direct 61.2 48963 103750 61400 22.7%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.41 61.21 0.00 0.00 1.0446 0.0000 3758322.37 3758322.37 0.00 58589.21 58589.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.31 77.30% 48963.07 45067 61614 48980.78 46946 51463 2316695 2316695 0.00
crit 13.90 22.70% 103749.97 90135 154034 103907.90 90135 125609 1441627 1441627 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1693 4.5% 12.8 23.57sec 39649 38669 Direct 12.8 2409 5116 2999 21.8%  
Periodic 221.5 1696 3572 2115 22.3% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.79 12.79 221.54 221.54 1.0254 1.3323 506950.38 506950.38 0.00 1644.52 38668.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.00 78.19% 2408.73 2231 3073 2408.62 2231 2645 24082 24082 0.00
crit 2.79 21.81% 5115.76 4463 7683 4928.01 0 7683 14263 14263 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 172.0 77.65% 1695.85 4 2151 1696.57 1650 1774 291736 291736 0.00
crit 49.5 22.35% 3572.26 23 5378 3575.59 3337 3910 176869 176869 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6253 16.6% 88.7 3.13sec 20998 0 Direct 88.7 16354 34116 20998 26.1%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.70 88.70 0.00 0.00 0.0000 0.0000 1862399.50 1862399.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.51 73.86% 16354.16 15985 17583 16354.04 15985 17259 1071354 1071354 0.00
crit 23.19 26.14% 34116.45 31970 43958 34125.42 31970 38035 791046 791046 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2892 7.7% 17.9 16.73sec 48463 47599 Direct 17.9 3903 8027 4775 21.1%  
Periodic 223.0 2811 5904 3501 22.3% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.87 17.87 223.05 223.05 1.0182 1.3308 866210.22 866210.22 0.00 2749.52 47599.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.09 78.85% 3902.87 3570 4917 3903.07 3570 4306 55008 55008 0.00
crit 3.78 21.15% 8027.49 7141 12292 7909.98 0 12292 30340 30340 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 173.3 77.70% 2811.02 2 3565 2812.19 2716 2955 487162 487162 0.00
crit 49.7 22.30% 5904.21 3 8912 5909.56 5481 6438 293701 293701 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
blood of the enemy
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:blood of the enemy
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.53sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.66sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9033 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:blood of the enemy
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:blood of the enemy
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.2 54.0 44.2sec 4.9sec 93.28% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.68%
  • arcanic_pulsar_2:10.24%
  • arcanic_pulsar_3:11.68%
  • arcanic_pulsar_4:10.81%
  • arcanic_pulsar_5:13.55%
  • arcanic_pulsar_6:10.31%
  • arcanic_pulsar_7:10.61%
  • arcanic_pulsar_8:14.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.7sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.5sec 182.5sec 8.11% 7.64% 0.0(0.0) 2.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Blood-Soaked 5.2 0.0 57.9sec 57.9sec 13.72% 0.00% 0.0(0.0) 5.1

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bloodsoaked
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:592.56

Stack Uptimes

  • bloodsoaked_1:13.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297168
  • name:Blood-Soaked
  • tooltip:Haste increased by $w1. While active Blood of the Enemy stacks are not granted.
  • description:{$@spelldesc297147=Your critical strikes with spells and abilities grant a stack of Blood-Soaked$?a297177[, increasing Critical Strike by {$297147s3=0}][]. Upon reaching {$297162u=40} stacks, you gain {$s2=0} Haste for {$297168d=8 seconds}.$?a297178[ Blood-Soaked has a {$297178s1=25}% chance of only consuming {$297178s2=30} stacks.][]}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Blood-Soaked (_counter) 4.8 207.7 65.7sec 1.4sec 86.90% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bloodsoaked_counter
  • max_stacks:40
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:9.09

Stack Uptimes

  • bloodsoaked_counter_1:2.53%
  • bloodsoaked_counter_2:2.28%
  • bloodsoaked_counter_3:2.13%
  • bloodsoaked_counter_4:2.06%
  • bloodsoaked_counter_5:2.03%
  • bloodsoaked_counter_6:1.99%
  • bloodsoaked_counter_7:1.95%
  • bloodsoaked_counter_8:1.95%
  • bloodsoaked_counter_9:1.91%
  • bloodsoaked_counter_10:5.86%
  • bloodsoaked_counter_11:2.47%
  • bloodsoaked_counter_12:2.43%
  • bloodsoaked_counter_13:2.41%
  • bloodsoaked_counter_14:2.40%
  • bloodsoaked_counter_15:2.37%
  • bloodsoaked_counter_16:2.34%
  • bloodsoaked_counter_17:2.29%
  • bloodsoaked_counter_18:2.28%
  • bloodsoaked_counter_19:2.25%
  • bloodsoaked_counter_20:2.23%
  • bloodsoaked_counter_21:2.18%
  • bloodsoaked_counter_22:2.18%
  • bloodsoaked_counter_23:2.14%
  • bloodsoaked_counter_24:2.12%
  • bloodsoaked_counter_25:2.10%
  • bloodsoaked_counter_26:2.10%
  • bloodsoaked_counter_27:2.07%
  • bloodsoaked_counter_28:2.06%
  • bloodsoaked_counter_29:2.06%
  • bloodsoaked_counter_30:2.03%
  • bloodsoaked_counter_31:2.01%
  • bloodsoaked_counter_32:2.00%
  • bloodsoaked_counter_33:1.99%
  • bloodsoaked_counter_34:1.97%
  • bloodsoaked_counter_35:1.95%
  • bloodsoaked_counter_36:1.95%
  • bloodsoaked_counter_37:1.95%
  • bloodsoaked_counter_38:1.92%
  • bloodsoaked_counter_39:1.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297162
  • name:Blood-Soaked
  • tooltip:$?a297177[Critical strike increased by $w2. ][]$@spellaura297147
  • description:{$@spelldesc297147=Your critical strikes with spells and abilities grant a stack of Blood-Soaked$?a297177[, increasing Critical Strike by {$297147s3=0}][]. Upon reaching {$297162u=40} stacks, you gain {$s2=0} Haste for {$297168d=8 seconds}.$?a297178[ Blood-Soaked has a {$297178s1=25}% chance of only consuming {$297178s2=30} stacks.][]}
  • max_stacks:40
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.3 0.0 37.4sec 37.4sec 25.94% 32.34% 0.0(0.0) 8.1

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.3sec 45.7sec 23.56% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.23% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.95%
  • ignition_mages_fuse_2:3.89%
  • ignition_mages_fuse_3:3.84%
  • ignition_mages_fuse_4:3.80%
  • ignition_mages_fuse_5:3.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 34.1 46.2 8.9sec 3.7sec 82.12% 99.80% 1.9(1.9) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.90%
  • lunar_empowerment_2:31.77%
  • lunar_empowerment_3:14.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.6 3.5 64.4sec 33.7sec 47.90% 0.00% 3.5(48.7) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.66%
  • overwhelming_power_9:1.71%
  • overwhelming_power_10:1.76%
  • overwhelming_power_11:1.81%
  • overwhelming_power_12:1.87%
  • overwhelming_power_13:1.92%
  • overwhelming_power_14:1.98%
  • overwhelming_power_15:2.04%
  • overwhelming_power_16:2.10%
  • overwhelming_power_17:2.16%
  • overwhelming_power_18:2.23%
  • overwhelming_power_19:2.30%
  • overwhelming_power_20:2.36%
  • overwhelming_power_21:2.44%
  • overwhelming_power_22:2.51%
  • overwhelming_power_23:2.59%
  • overwhelming_power_24:2.66%
  • overwhelming_power_25:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Seething Rage 3.7 0.0 91.2sec 91.2sec 6.11% 0.00% 0.0(0.0) 3.6

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_seething_rage
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • seething_rage_1:6.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297126
  • name:Seething Rage
  • tooltip:Critical strike damage increased by $w1%.
  • description:{$@spelldesc297122=Increases your critical hit damage by $297126m% for {$297126d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Solar Empowerment 24.9 51.9 11.9sec 3.9sec 85.99% 79.10% 0.3(0.3) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.55%
  • solar_empowerment_2:39.79%
  • solar_empowerment_3:17.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 46.1 20.2sec 4.9sec 97.81% 93.01% 15.9(15.9) 11.5

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.65%
  • starlord_2:22.49%
  • starlord_3:60.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.0sec 45.5sec 23.71% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.71%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
blood of the enemy
starsurge Astral Power 61.4 2456.3 40.0 40.0 1530.1
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 94.78 758.15 (31.34%) 8.00 0.06 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.31%) 40.00 0.00 0.00%
sunfire Astral Power 17.87 53.62 (2.22%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.76 179.02 (7.40%) 4.00 0.02 0.01%
moonfire Astral Power 14.06 42.18 (1.74%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.79 102.29 (4.23%) 8.00 0.00 0.00%
lunar_strike Astral Power 77.30 927.59 (38.35%) 12.00 0.06 0.01%
natures_balance Astral Power 400.43 200.21 (8.28%) 0.50 0.01 0.00%
arcanic_pulsar Astral Power 6.31 75.69 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.06 8.19
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.05 0.00 71.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data blood of the enemy Fight Length
Count 7600
Mean 299.94
Minimum 240.00
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data blood of the enemy Damage Per Second
Count 7600
Mean 37551.43
Minimum 34033.00
Maximum 42697.69
Spread ( max - min ) 8664.69
Range [ ( max - min ) / 2 * 100% ] 11.54%
Standard Deviation 1276.2218
5th Percentile 35541.02
95th Percentile 39703.27
( 95th Percentile - 5th Percentile ) 4162.25
Mean Distribution
Standard Deviation 14.6393
95.00% Confidence Intervall ( 37522.74 - 37580.12 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4438
0.1 Scale Factor Error with Delta=300 13904
0.05 Scale Factor Error with Delta=300 55616
0.01 Scale Factor Error with Delta=300 1390388
Priority Target DPS
Sample Data blood of the enemy Priority Target Damage Per Second
Count 7600
Mean 37551.43
Minimum 34033.00
Maximum 42697.69
Spread ( max - min ) 8664.69
Range [ ( max - min ) / 2 * 100% ] 11.54%
Standard Deviation 1276.2218
5th Percentile 35541.02
95th Percentile 39703.27
( 95th Percentile - 5th Percentile ) 4162.25
Mean Distribution
Standard Deviation 14.6393
95.00% Confidence Intervall ( 37522.74 - 37580.12 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4438
0.1 Scale Factor Error with Delta=300 13904
0.05 Scale Factor Error with Delta=300 55616
0.01 Scale Factor Error with Delta=300 1390388
DPS(e)
Sample Data blood of the enemy Damage Per Second (Effective)
Count 7600
Mean 37551.43
Minimum 34033.00
Maximum 42697.69
Spread ( max - min ) 8664.69
Range [ ( max - min ) / 2 * 100% ] 11.54%
Damage
Sample Data blood of the enemy Damage
Count 7600
Mean 11234217.48
Minimum 8725740.94
Maximum 13745511.68
Spread ( max - min ) 5019770.74
Range [ ( max - min ) / 2 * 100% ] 22.34%
DTPS
Sample Data blood of the enemy Damage Taken Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data blood of the enemy Healing Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data blood of the enemy Healing Per Second (Effective)
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data blood of the enemy Heal
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data blood of the enemy Healing Taken Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data blood of the enemy Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data blood of the enemyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data blood of the enemy Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
H 3.68 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 thorns
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.88 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 61.41 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.86 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.98 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.74 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.08 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.79 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 77.67 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 94.03 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.27 sunfire

Sample Sequence

0123456789ACDKONPIFGHKRQKRQKRQRQKNRQORQRKPKRLQQKQQRRRRRRKRQKRQRJKMNQKPQRQKRQKRQQNKORQRKRQPQKRQQNQKRKRQKMRQRKRPQHNQQRKRKORQKRQRQKNRPQQRRKQGKRQRQKMNQQKRQQRJKPQKRQKRONQKRQQRRRKKQQPNKRQKRQMRRRRRKQIEFKHKNPRQKORQRKRQRQRKRLQKQQRKRPKRQMQRRNKQKQQRKQRRRKOPQNRRKGQKQRRKQRRRRRRRRJKRKRK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask blood of the enemy 58.0/100: 58% astral_power
Pre precombat 1 food blood of the enemy 58.0/100: 58% astral_power
Pre precombat 2 augmentation blood of the enemy 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power lunar_empowerment, battle_potion_of_intellect
0:01.248 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, bloodsoaked_counter, battle_potion_of_intellect
0:02.183 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, bloodsoaked_counter, battle_potion_of_intellect
0:03.117 default P stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, bloodsoaked_counter, battle_potion_of_intellect
0:04.050 default I celestial_alignment Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, bloodsoaked_counter, battle_potion_of_intellect
0:04.862 default F berserking Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, bloodsoaked_counter, battle_potion_of_intellect
0:04.862 default G use_items Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, bloodsoaked_counter, battle_potion_of_intellect
0:04.862 default H blood_of_the_enemy Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, bloodsoaked_counter, battle_potion_of_intellect, ignition_mages_fuse
0:05.617 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, bloodsoaked_counter(2), battle_potion_of_intellect, ignition_mages_fuse
0:06.373 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), bloodsoaked_counter(3), battle_potion_of_intellect, ignition_mages_fuse
0:07.127 default Q lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), bloodsoaked_counter(4), battle_potion_of_intellect, ignition_mages_fuse
0:08.003 default K starsurge Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), bloodsoaked_counter(6), battle_potion_of_intellect, ignition_mages_fuse
0:08.758 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(8), battle_potion_of_intellect, ignition_mages_fuse
0:09.513 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), bloodsoaked_counter(9), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.332 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked_counter(11), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.087 default R solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(13), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.841 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), bloodsoaked_counter(15), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.659 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked_counter(18), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.413 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), bloodsoaked_counter(18), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.202 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked_counter(19), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.955 default N sunfire Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(21), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.709 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(21), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.464 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), bloodsoaked_counter(23), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.253 default O moonfire Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked_counter(24), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.007 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked_counter(26), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.762 default Q lunar_strike Fluffy_Pillow 58.5/100: 59% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), bloodsoaked_counter(27), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.598 default R solar_wrath Fluffy_Pillow 71.0/100: 71% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), bloodsoaked_counter(29), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.353 default K starsurge Fluffy_Pillow 79.5/100: 80% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, bloodsoaked_counter(30), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.107 default P stellar_flare Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, bloodsoaked_counter(30), battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.860 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, bloodsoaked_counter(31), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.615 default R solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), bloodsoaked_counter(31), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.369 default L sunfire Fluffy_Pillow 17.5/100: 18% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), bloodsoaked_counter(32), ignition_mages_fuse(5)
0:24.125 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord(2), bloodsoaked_counter(34), ignition_mages_fuse(5)
0:25.078 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), bloodsoaked_counter(36)
0:26.232 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2), bloodsoaked_counter(36)
0:27.138 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(36)
0:28.262 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(36)
0:29.385 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(36)
0:30.141 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(36)
0:30.897 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, bloodsoaked_counter(36)
0:31.781 default R solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, bloodsoaked_counter(36)
0:32.662 default R solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, bloodsoaked_counter(36)
0:33.543 default R solar_wrath Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(38), conch_of_dark_whispers
0:34.426 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(39), conch_of_dark_whispers
0:35.309 default R solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(10), bloodsoaked, conch_of_dark_whispers
0:36.064 default Q lunar_strike Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked_counter(10), bloodsoaked, conch_of_dark_whispers
0:36.976 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(10), bloodsoaked, conch_of_dark_whispers
0:37.731 default R solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(10), bloodsoaked, conch_of_dark_whispers
0:38.486 default Q lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked_counter(10), bloodsoaked, conch_of_dark_whispers
0:39.396 default R solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(10), bloodsoaked, conch_of_dark_whispers
0:40.152 default J cancel_buff Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(10), bloodsoaked, conch_of_dark_whispers
0:40.152 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), torrent_of_elements, bloodsoaked_counter(10), bloodsoaked, conch_of_dark_whispers
0:40.932 default M moonfire Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements, bloodsoaked_counter(10), bloodsoaked, conch_of_dark_whispers
0:41.690 default N sunfire Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord, bloodsoaked_counter(10), bloodsoaked, conch_of_dark_whispers
0:42.821 default Q lunar_strike Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord, bloodsoaked_counter(10), conch_of_dark_whispers
0:44.365 default K starsurge Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, bloodsoaked_counter(13), conch_of_dark_whispers
0:45.577 default P stellar_flare Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), bloodsoaked_counter(14), conch_of_dark_whispers
0:46.754 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), bloodsoaked_counter(15), conch_of_dark_whispers
0:48.254 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), bloodsoaked_counter(16), conch_of_dark_whispers
0:49.256 default Q lunar_strike Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(17)
0:50.757 default K starsurge Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(18)
0:51.934 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(18)
0:52.907 default Q lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(19)
0:54.366 default K starsurge Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(20)
0:55.512 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(21)
0:56.485 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(21)
0:57.944 default Q lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(22)
0:59.404 default N sunfire Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), bloodsoaked_counter(22)
1:00.549 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(5), solar_empowerment(2), bloodsoaked_counter(23)
1:01.798 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord, bloodsoaked_counter(23)
1:03.008 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord, bloodsoaked_counter(23)
1:04.039 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord, bloodsoaked_counter(23)
1:05.583 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord, bloodsoaked_counter(25)
1:06.612 default K starsurge Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, bloodsoaked_counter(25)
1:07.826 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), bloodsoaked_counter(25)
1:08.829 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2), bloodsoaked_counter(27)
1:10.330 default P stellar_flare Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(28)
1:11.507 default Q lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(28)
1:13.009 default K starsurge Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(31)
1:14.187 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(32)
1:15.159 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(32)
1:16.619 default Q lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(33)
1:18.077 default N sunfire Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(33)
1:19.222 default Q lunar_strike Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(36)
1:20.682 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(8), solar_empowerment(2), bloodsoaked_counter(37)
1:21.931 default R solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord, bloodsoaked_counter(37)
1:22.827 default K starsurge Fluffy_Pillow 71.0/100: 71% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, bloodsoaked_counter(37)
1:23.881 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), bloodsoaked_counter(37)
1:24.752 default Q lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(37)
1:26.056 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(37)
1:27.079 default M moonfire Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(39)
1:28.077 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(10), bloodsoaked
1:28.985 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(10), bloodsoaked
1:30.346 default R solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked_counter(10), bloodsoaked
1:31.254 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(10), bloodsoaked
1:32.323 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(10), bloodsoaked
1:33.233 default P stellar_flare Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(10), bloodsoaked
1:34.302 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(10), bloodsoaked
1:35.661 default H blood_of_the_enemy Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(10)
1:36.808 default N sunfire Fluffy_Pillow 47.5/100: 48% astral_power seething_rage, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(11)
1:37.953 default Q lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power seething_rage, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(12)
1:39.413 default Q lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power seething_rage, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), bloodsoaked_counter(13)
1:40.750 default R solar_wrath Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(3), solar_empowerment(3), overwhelming_power(23), bloodsoaked_counter(13)
1:41.727 default K starsurge Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar(3), solar_empowerment(2), overwhelming_power(22), bloodsoaked_counter(13)
1:42.880 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(21), bloodsoaked_counter(13)
1:43.836 default K starsurge Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(25), bloodsoaked_counter(16)
1:44.941 default O moonfire Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(24), bloodsoaked_counter(17)
1:46.023 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(22), bloodsoaked_counter(19)
1:46.946 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(22), bloodsoaked_counter(20)
1:48.331 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(20), bloodsoaked_counter(22)
1:49.425 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(19), bloodsoaked_counter(22)
1:50.336 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18), bloodsoaked_counter(22)
1:51.701 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(17), bloodsoaked_counter(23)
1:52.618 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(16), bloodsoaked_counter(24)
1:53.995 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(25), bloodsoaked_counter(24)
1:55.044 default N sunfire Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(23), bloodsoaked_counter(24)
1:56.099 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(22), bloodsoaked_counter(25)
1:56.997 default P stellar_flare Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22), bloodsoaked_counter(25)
1:58.054 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25), bloodsoaked_counter(26)
1:59.387 default Q lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), bloodsoaked_counter(27)
2:00.724 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(23), bloodsoaked_counter(28)
2:01.620 default R solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(22), bloodsoaked_counter(28)
2:02.520 default K starsurge Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(7), lunar_empowerment, torrent_of_elements, overwhelming_power(21), bloodsoaked_counter(28)
2:03.675 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(20), bloodsoaked_counter(28)
2:05.111 default G use_items Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(18), bloodsoaked_counter(29), conch_of_dark_whispers
2:05.111 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(18), bloodsoaked_counter(29), conch_of_dark_whispers, ignition_mages_fuse
2:06.203 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(17), bloodsoaked_counter(30), conch_of_dark_whispers, ignition_mages_fuse
2:06.992 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(17), bloodsoaked_counter(30), conch_of_dark_whispers, ignition_mages_fuse
2:08.174 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(15), bloodsoaked_counter(34), conch_of_dark_whispers, ignition_mages_fuse
2:08.967 default Q lunar_strike Fluffy_Pillow 69.5/100: 70% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(15), bloodsoaked_counter(34), conch_of_dark_whispers, ignition_mages_fuse
2:10.156 default K starsurge Fluffy_Pillow 86.5/100: 87% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(13), bloodsoaked_counter(36), conch_of_dark_whispers, ignition_mages_fuse(2)
2:11.062 default M moonfire Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12), bloodsoaked_counter(37), conch_of_dark_whispers, ignition_mages_fuse(2)
2:11.944 default N sunfire Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12), bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse(2)
2:12.896 default Q lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(11), bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse(2)
2:14.113 default Q lunar_strike Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(9), bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse(3)
2:15.295 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(8), bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse(3)
2:16.227 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(7), bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.024 default Q lunar_strike Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(6), bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse(3)
2:18.216 default Q lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(5), bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse(4)
2:19.374 default R solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(4), bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse(4)
2:20.149 default J cancel_buff Fluffy_Pillow 99.0/100: 99% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(3), ignition_mages_fuse(4)
2:20.149 default K starsurge Fluffy_Pillow 99.0/100: 99% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, torrent_of_elements, overwhelming_power(3), ignition_mages_fuse(4)
2:21.207 default P stellar_flare Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(2), ignition_mages_fuse(5)
2:22.202 default Q lunar_strike Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power, bloodsoaked_counter(2), ignition_mages_fuse(5)
2:23.475 default K starsurge Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, bloodsoaked_counter(3), ignition_mages_fuse(5)
2:24.476 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, bloodsoaked_counter(4), ignition_mages_fuse(5)
2:25.302 default Q lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter(4)
2:26.803 default K starsurge Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter(5)
2:27.982 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked_counter(6)
2:28.956 default O moonfire Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(6)
2:30.102 default N sunfire Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(7)
2:31.248 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(7)
2:32.707 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(7)
2:33.853 default R solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(8)
2:34.826 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(9)
2:36.284 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(11)
2:37.744 default R solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), bloodsoaked_counter(11)
2:38.717 default R solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), bloodsoaked_counter(11)
2:39.692 default R solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(6), starlord(3), bloodsoaked_counter(11)
2:40.836 default K starsurge Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(6), bloodsoaked_counter(12)
2:42.083 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(13)
2:43.295 default Q lunar_strike Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(15)
2:44.794 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(16)
2:46.293 default P stellar_flare Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), bloodsoaked_counter(16)
2:47.470 default N sunfire Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), bloodsoaked_counter(18)
2:48.649 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), bloodsoaked_counter(18)
2:49.827 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked_counter(18)
2:50.676 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(18)
2:51.946 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power celestial_alignment, solar_empowerment(2), starlord(3), bloodsoaked_counter(18)
2:52.944 default R solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked_counter(20)
2:53.793 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(21)
2:55.062 default M moonfire Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord(3), bloodsoaked_counter(21)
2:56.059 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), bloodsoaked_counter(21)
2:57.033 default R solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, solar_empowerment, starlord(3), bloodsoaked_counter(22)
2:58.007 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar, starlord(3), bloodsoaked_counter(23)
2:59.151 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar, starlord(3), bloodsoaked_counter(25)
3:00.296 default R solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar, starlord(3), bloodsoaked_counter(25)
3:01.442 default K starsurge Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar, bloodsoaked_counter(25)
3:02.691 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(25)
3:04.235 default I celestial_alignment Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord, bloodsoaked_counter(26)
3:05.289 default E potion Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord, bloodsoaked_counter(29)
3:05.289 default F berserking Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord, bloodsoaked_counter(29), battle_potion_of_intellect
3:05.289 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power berserking, arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord, bloodsoaked_counter(29), battle_potion_of_intellect
3:06.249 default H blood_of_the_enemy Fluffy_Pillow 58.0/100: 58% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(31), battle_potion_of_intellect
3:07.181 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(33), battle_potion_of_intellect
3:08.113 default N sunfire Fluffy_Pillow 19.0/100: 19% astral_power berserking, seething_rage, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(35), battle_potion_of_intellect
3:09.018 default P stellar_flare Fluffy_Pillow 23.0/100: 23% astral_power berserking, seething_rage, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(35), battle_potion_of_intellect
3:09.925 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power berserking, seething_rage, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(36), battle_potion_of_intellect
3:10.697 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power berserking, seething_rage, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(39), battle_potion_of_intellect
3:11.851 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked, battle_potion_of_intellect
3:12.698 default O moonfire Fluffy_Pillow 13.0/100: 13% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked, battle_potion_of_intellect
3:13.543 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked, battle_potion_of_intellect
3:14.296 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked, battle_potion_of_intellect
3:15.371 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked, battle_potion_of_intellect
3:16.125 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked, battle_potion_of_intellect
3:16.971 default R solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked, battle_potion_of_intellect
3:17.727 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked, battle_potion_of_intellect
3:18.911 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked, battle_potion_of_intellect
3:19.700 default Q lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
3:20.970 default R solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(6), celestial_alignment, solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
3:21.819 default K starsurge Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, torrent_of_elements, bloodsoaked_counter(2), battle_potion_of_intellect
3:22.906 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, bloodsoaked_counter(2), battle_potion_of_intellect
3:23.803 default L sunfire Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, bloodsoaked_counter(3), battle_potion_of_intellect
3:24.859 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(7), lunar_empowerment(2), starlord, torrent_of_elements, bloodsoaked_counter(3), battle_potion_of_intellect
3:26.402 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, bloodsoaked_counter(3), battle_potion_of_intellect
3:27.614 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter(3), battle_potion_of_intellect
3:29.114 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(3), battle_potion_of_intellect
3:30.613 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(2), bloodsoaked_counter(4)
3:31.615 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), bloodsoaked_counter(4)
3:32.794 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked_counter(4)
3:33.641 default P stellar_flare Fluffy_Pillow 33.0/100: 33% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(5)
3:34.637 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(5)
3:35.633 default R solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(7)
3:36.484 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(7)
3:37.753 default M moonfire Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(25), bloodsoaked_counter(8)
3:38.665 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), bloodsoaked_counter(10)
3:40.003 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(22), bloodsoaked_counter(10)
3:40.903 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(22), bloodsoaked_counter(11)
3:41.803 default N sunfire Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(21), bloodsoaked_counter(11)
3:42.863 default K starsurge Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar, lunar_empowerment, overwhelming_power(20), bloodsoaked_counter(12)
3:44.023 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(18), bloodsoaked_counter(13)
3:45.470 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(17), bloodsoaked_counter(14)
3:46.609 default Q lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(16), bloodsoaked_counter(17)
3:48.025 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(14), bloodsoaked_counter(17)
3:49.449 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), overwhelming_power(13), bloodsoaked_counter(17)
3:50.403 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2), overwhelming_power(12), bloodsoaked_counter(17)
3:51.530 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(11), bloodsoaked_counter(19)
3:52.931 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(10), bloodsoaked_counter(19)
3:53.870 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(9), bloodsoaked_counter(20)
3:54.813 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(8), bloodsoaked_counter(20)
3:55.926 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(7), bloodsoaked_counter(21)
3:57.043 default O moonfire Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(5), bloodsoaked_counter(21)
3:58.168 default P stellar_flare Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(4), bloodsoaked_counter(21)
3:59.298 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(3), bloodsoaked_counter(21)
4:00.740 default N sunfire Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(2), bloodsoaked_counter(21)
4:01.878 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power, bloodsoaked_counter(21)
4:02.849 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(23)
4:03.822 default K starsurge Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(5), torrent_of_elements, bloodsoaked_counter(24)
4:05.071 default G use_items Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, bloodsoaked_counter(24), conch_of_dark_whispers
4:05.071 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, bloodsoaked_counter(24), conch_of_dark_whispers, ignition_mages_fuse
4:06.552 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(6), solar_empowerment, starlord, torrent_of_elements, bloodsoaked_counter(27), conch_of_dark_whispers, ignition_mages_fuse
4:07.714 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter(28), conch_of_dark_whispers, ignition_mages_fuse
4:09.154 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(2), torrent_of_elements, bloodsoaked_counter(30), conch_of_dark_whispers, ignition_mages_fuse(2)
4:10.076 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter(30), conch_of_dark_whispers, ignition_mages_fuse(2)
4:10.999 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2), bloodsoaked_counter(31), conch_of_dark_whispers, ignition_mages_fuse(2)
4:12.085 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(31), conch_of_dark_whispers, ignition_mages_fuse(2)
4:13.432 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), bloodsoaked_counter(31), conch_of_dark_whispers, ignition_mages_fuse(3)
4:14.294 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), bloodsoaked_counter(32), conch_of_dark_whispers, ignition_mages_fuse(3)
4:15.160 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(8), starlord(3), bloodsoaked_counter(32), conch_of_dark_whispers, ignition_mages_fuse(3)
4:16.177 default R solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(8), starlord(3), bloodsoaked_counter(33), conch_of_dark_whispers, ignition_mages_fuse(3)
4:17.193 default R solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(8), starlord(3), bloodsoaked_counter(34), conch_of_dark_whispers, ignition_mages_fuse(4)
4:18.173 default R solar_wrath Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(8), starlord(3), bloodsoaked_counter(34), conch_of_dark_whispers, ignition_mages_fuse(4)
4:19.153 default R solar_wrath Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(8), starlord(3), bloodsoaked_counter(35), conch_of_dark_whispers, ignition_mages_fuse(4)
4:20.135 default R solar_wrath Fluffy_Pillow 88.0/100: 88% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(25), bloodsoaked_counter(35), ignition_mages_fuse(4)
4:21.041 default J cancel_buff Fluffy_Pillow 97.0/100: 97% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(24), bloodsoaked_counter(37), ignition_mages_fuse(4)
4:21.041 default K starsurge Fluffy_Pillow 97.0/100: 97% astral_power arcanic_pulsar(8), lunar_empowerment, overwhelming_power(24), bloodsoaked_counter(37), ignition_mages_fuse(4)
4:22.031 default R solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(23), bloodsoaked_counter(39), ignition_mages_fuse(5)
4:22.786 default K starsurge Fluffy_Pillow 78.0/100: 78% astral_power celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(23), bloodsoaked, ignition_mages_fuse(5)
4:23.556 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(22), bloodsoaked, ignition_mages_fuse(5)
4:24.310 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(21), bloodsoaked, ignition_mages_fuse(5)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="blood of the enemy"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/thorns
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

conflict+strife : 39677 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
39677.3 39677.3 27.4 / 0.069% 4723.1 / 11.9% 4902.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 8.0 Astral Power 0.00% 58.3 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
conflict+strife 39677
Heed My Call 304 (433) 0.8% (1.1%) 8.2 33.31sec 15926 0 Direct 8.2 9459 18905 11151 17.9%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.16 8.16 0.00 0.00 0.0000 0.0000 90952.55 90952.55 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.69 82.08% 9458.61 8901 10236 9457.03 0 10236 63322 63322 0.00
crit 1.46 17.92% 18904.65 17802 20472 14660.77 0 20472 27631 27631 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 130 0.3% 8.2 33.31sec 4775 0 Direct 8.2 4053 8108 4775 17.8%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.16 8.16 0.00 0.00 0.0000 0.0000 38942.83 38942.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.70 82.20% 4053.05 3815 4387 4052.99 0 4387 27175 27175 0.00
crit 1.45 17.80% 8107.83 7629 8774 6252.52 0 8774 11768 11768 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5156 13.0% 76.1 3.84sec 20301 15495 Direct 76.1 17224 34432 20302 17.9%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.10 76.10 0.00 0.00 1.3102 0.0000 1544946.45 1544946.45 0.00 15495.49 15495.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.49 82.12% 17224.30 8882 22219 17230.72 16596 18180 1076388 1076388 0.00
crit 13.61 17.88% 34431.75 18168 44438 34439.04 31329 39315 468559 468559 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2536 6.4% 14.0 21.36sec 54083 53044 Direct 14.0 2958 5921 3485 17.8%  
Periodic 221.0 2727 5450 3216 18.0% 99.0%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.04 14.04 220.97 220.97 1.0196 1.3434 759595.97 759595.97 0.00 2441.07 53044.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.55 82.23% 2958.29 2589 3727 2959.87 2752 3246 34167 34167 0.00
crit 2.50 17.77% 5920.54 5177 7453 5519.33 0 7453 14775 14775 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.3 82.03% 2726.80 2 3470 2727.85 2650 2852 494258 494258 0.00
crit 39.7 17.97% 5449.64 24 6939 5451.66 5103 5957 216396 216396 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 822 2.1% 44.1 6.60sec 5579 0 Direct 44.1 4730 9460 5579 18.0%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.13 44.13 0.00 0.00 0.0000 0.0000 246217.68 246217.68 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.21 82.05% 4730.16 4180 6018 4732.10 4467 5182 171264 171264 0.00
crit 7.92 17.95% 9459.94 8360 12036 9459.18 0 11708 74954 74954 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2881 (4560) 7.3% (11.5%) 91.9 3.20sec 14874 16478 Direct 92.4 7925 15845 9343 17.9%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.86 92.38 0.00 0.00 0.9026 0.0000 863045.46 863045.46 0.00 16478.30 16478.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.84 82.10% 7924.66 6967 10030 7928.87 7661 8326 601021 601021 0.00
crit 16.54 17.90% 15845.28 13933 20060 15856.38 14551 17849 262024 262024 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1679 4.2% 73.5 3.99sec 6847 0 Direct 73.5 6847 0 6847 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.49 73.49 0.00 0.00 0.0000 0.0000 503220.10 503220.10 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.49 100.00% 6847.17 5086 14644 6850.07 5999 8141 503220 503220 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10633.49
  • base_dd_max:10633.49
  • base_dd_mult:1.00
 
Starsurge 12156 30.7% 60.6 4.99sec 60106 56964 Direct 60.4 51114 102130 60294 18.0%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.55 60.37 0.00 0.00 1.0552 0.0000 3639708.70 3639708.70 0.00 56963.90 56963.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.50 82.00% 51113.56 45067 64414 51137.44 49382 53695 2530247 2530247 0.00
crit 10.86 18.00% 102129.55 90135 128828 102153.01 0 121063 1109462 1109462 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1646 4.2% 12.8 23.57sec 38675 37248 Direct 12.8 2490 4981 2935 17.9%  
Periodic 218.6 1768 3534 2085 18.0% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.75 12.75 218.62 218.62 1.0383 1.3464 493202.27 493202.27 0.00 1603.50 37248.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.48 82.14% 2489.95 2231 3213 2490.48 2322 2703 26083 26083 0.00
crit 2.28 17.86% 4980.59 4463 6425 4580.85 0 6425 11341 11341 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 179.4 82.05% 1767.72 1 2249 1768.46 1716 1845 317081 317081 0.00
crit 39.2 17.95% 3534.21 76 4498 3535.61 3306 3842 138697 138697 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5887 14.8% 88.0 3.16sec 19918 0 Direct 88.0 16899 33811 19918 17.9%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.02 88.02 0.00 0.00 0.0000 0.0000 1753108.00 1753108.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.30 82.15% 16899.02 15985 18383 16897.79 16293 17858 1221824 1221824 0.00
crit 15.71 17.85% 33811.46 31970 36765 33812.70 32247 36324 531284 531284 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2821 7.1% 17.7 16.82sec 47625 46354 Direct 17.7 4052 8100 4780 18.0%  
Periodic 220.2 2929 5854 3454 17.9% 98.7%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.75 17.75 220.16 220.16 1.0274 1.3443 845223.26 845223.26 0.00 2690.02 46354.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.56 82.02% 4052.03 3570 5140 4052.75 3761 4429 58986 58986 0.00
crit 3.19 17.98% 8100.46 7141 10281 7838.31 0 10281 25845 25845 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.7 82.07% 2929.37 2 3727 2930.57 2845 3060 529290 529290 0.00
crit 39.5 17.93% 5853.75 8 7453 5856.00 5537 6327 231103 231103 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Thorns 3661 9.2% 63.0 4.68sec 17418 200058 Direct 55.9 16646 33277 19626 17.9%  

Stats details: thorns

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.97 55.88 0.00 0.00 0.0871 0.0000 1096717.23 1096717.23 0.00 200057.87 200057.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.87 82.08% 16645.99 15447 19338 16647.10 15925 17520 763567 763567 0.00
crit 10.01 17.92% 33277.29 30894 38677 33283.21 31245 36326 333150 333150 0.00
 
 

Action details: thorns

Static Values
  • id:305497
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:305497
  • name:Thorns
  • school:nature
  • tooltip:Melee attackers take Nature damage when hit and their movement speed is slowed by {$232559s1=50}% for {$232559d=4 seconds}.
  • description:Sprout thorns for {$d=12 seconds} on the friendly target. When victim to melee attacks, thorns deals {$305496s1=0} Nature damage back to the attacker. Attackers also have their movement speed reduced by {$232559s1=50}% for {$232559d=4 seconds}.
 
Simple Action Stats Execute Interval
conflict+strife
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:conflict+strife
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.37sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.27sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8999 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:conflict+strife
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:conflict+strife
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.1 53.2 44.6sec 5.0sec 93.06% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.54%
  • arcanic_pulsar_2:10.82%
  • arcanic_pulsar_3:11.84%
  • arcanic_pulsar_4:10.24%
  • arcanic_pulsar_5:13.53%
  • arcanic_pulsar_6:9.93%
  • arcanic_pulsar_7:10.62%
  • arcanic_pulsar_8:14.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 189.1sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.4sec 182.4sec 8.11% 7.80% 0.0(0.0) 2.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.6sec 37.6sec 25.79% 32.42% 0.0(0.0) 8.1

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.9sec 45.6sec 23.67% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.18% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.94%
  • ignition_mages_fuse_2:3.88%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 33.1 46.0 9.2sec 3.8sec 82.48% 99.74% 1.9(1.9) 0.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.68%
  • lunar_empowerment_2:32.06%
  • lunar_empowerment_3:14.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.5 3.4 64.5sec 34.1sec 47.57% 0.00% 3.4(47.5) 0.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.61%
  • overwhelming_power_8:1.66%
  • overwhelming_power_9:1.70%
  • overwhelming_power_10:1.75%
  • overwhelming_power_11:1.80%
  • overwhelming_power_12:1.85%
  • overwhelming_power_13:1.91%
  • overwhelming_power_14:1.97%
  • overwhelming_power_15:2.02%
  • overwhelming_power_16:2.08%
  • overwhelming_power_17:2.14%
  • overwhelming_power_18:2.21%
  • overwhelming_power_19:2.27%
  • overwhelming_power_20:2.34%
  • overwhelming_power_21:2.42%
  • overwhelming_power_22:2.49%
  • overwhelming_power_23:2.56%
  • overwhelming_power_24:2.63%
  • overwhelming_power_25:1.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 24.6 51.3 12.0sec 4.0sec 85.87% 79.68% 0.3(0.3) 0.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.31%
  • solar_empowerment_2:39.81%
  • solar_empowerment_3:17.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 45.3 20.2sec 5.0sec 97.48% 92.69% 15.2(15.2) 11.5

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.58%
  • starlord_2:22.78%
  • starlord_3:60.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Strife 2.1 52.5 109.5sec 5.4sec 97.75% 0.00% 39.5(39.5) 1.1

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_strife
  • max_stacks:8
  • duration:14.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:50.47

Stack Uptimes

  • strife_1:3.81%
  • strife_2:3.69%
  • strife_3:3.57%
  • strife_4:3.48%
  • strife_5:3.36%
  • strife_6:3.23%
  • strife_7:3.16%
  • strife_8:73.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:304056
  • name:Strife
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc304081=Your spells and abilities have a chance to increase your Versatility by {$s1=0} for {$304056d=8 seconds}, stacking up to {$304056u=5} times. Being the vicitim of a loss of control or movement impairing effect also grants a stack of Strife.}
  • max_stacks:5
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Thorns 7.1 0.0 45.4sec 45.4sec 27.98% 0.00% 0.0(0.0) 6.9

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_thorns
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • thorns_1:27.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:305497
  • name:Thorns
  • tooltip:Melee attackers take Nature damage when hit and their movement speed is slowed by {$232559s1=50}% for {$232559d=4 seconds}.
  • description:Sprout thorns for {$d=12 seconds} on the friendly target. When victim to melee attacks, thorns deals {$305496s1=0} Nature damage back to the attacker. Attackers also have their movement speed reduced by {$232559s1=50}% for {$232559d=4 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:45.00
  • default_chance:100.00%
Torrent of Elements 4.3 1.2 60.8sec 45.4sec 23.71% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.71%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
conflict+strife
starsurge Astral Power 60.6 2422.2 40.0 40.0 1502.6
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 92.86 742.82 (31.15%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.35%) 40.00 0.00 0.00%
sunfire Astral Power 17.75 53.24 (2.23%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.13 176.51 (7.40%) 4.00 0.01 0.01%
moonfire Astral Power 14.04 42.13 (1.77%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.75 102.02 (4.28%) 8.00 0.00 0.00%
lunar_strike Astral Power 76.10 913.15 (38.29%) 12.00 0.06 0.01%
natures_balance Astral Power 400.43 200.21 (8.40%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.22 74.58 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.95 8.08
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.21 0.00 79.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data conflict+strife Fight Length
Count 7600
Mean 299.94
Minimum 240.00
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data conflict+strife Damage Per Second
Count 7600
Mean 39677.27
Minimum 35959.35
Maximum 44745.65
Spread ( max - min ) 8786.30
Range [ ( max - min ) / 2 * 100% ] 11.07%
Standard Deviation 1219.1268
5th Percentile 37726.20
95th Percentile 41762.89
( 95th Percentile - 5th Percentile ) 4036.69
Mean Distribution
Standard Deviation 13.9843
95.00% Confidence Intervall ( 39649.86 - 39704.68 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3627
0.1 Scale Factor Error with Delta=300 12688
0.05 Scale Factor Error with Delta=300 50751
0.01 Scale Factor Error with Delta=300 1268766
Priority Target DPS
Sample Data conflict+strife Priority Target Damage Per Second
Count 7600
Mean 39677.27
Minimum 35959.35
Maximum 44745.65
Spread ( max - min ) 8786.30
Range [ ( max - min ) / 2 * 100% ] 11.07%
Standard Deviation 1219.1268
5th Percentile 37726.20
95th Percentile 41762.89
( 95th Percentile - 5th Percentile ) 4036.69
Mean Distribution
Standard Deviation 13.9843
95.00% Confidence Intervall ( 39649.86 - 39704.68 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3627
0.1 Scale Factor Error with Delta=300 12688
0.05 Scale Factor Error with Delta=300 50751
0.01 Scale Factor Error with Delta=300 1268766
DPS(e)
Sample Data conflict+strife Damage Per Second (Effective)
Count 7600
Mean 39677.27
Minimum 35959.35
Maximum 44745.65
Spread ( max - min ) 8786.30
Range [ ( max - min ) / 2 * 100% ] 11.07%
Damage
Sample Data conflict+strife Damage
Count 7600
Mean 11874880.50
Minimum 9297602.34
Maximum 14464437.17
Spread ( max - min ) 5166834.83
Range [ ( max - min ) / 2 * 100% ] 21.76%
DTPS
Sample Data conflict+strife Damage Taken Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data conflict+strife Healing Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data conflict+strife Healing Per Second (Effective)
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data conflict+strife Heal
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data conflict+strife Healing Taken Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data conflict+strife Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data conflict+strifeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data conflict+strife Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
H 7.08 thorns
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.79 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 60.56 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.73 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.82 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.77 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.23 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.75 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 76.46 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 92.12 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.25 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRKRQRKRQRKRQRNRORQRKRKPRLQKQQQRRRRRKRQKRQRSKKOQHPKRQRQKRQQRNRKOQKRQRPQRKRQNQRRKRKRKRMQQHKQNPRQRRQKKQORKRQNRKRQPQRRRKQGKRQKRQMNRKHQQRRRPRKKQQNKORQRRKQRRRQRKPKNQQKORQKRLQHQQIEFKRKRPRKRQKORQNKRQRQRLQKQKQQRKPRQKRMQNQRRHKQKQRRKQROPQKNQRQGRKQKRQQKRQRRQRKR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask conflict+strife 58.0/100: 58% astral_power
Pre precombat 1 food conflict+strife 58.0/100: 58% astral_power
Pre precombat 2 augmentation conflict+strife 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H thorns Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:00.833 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power thorns, battle_potion_of_intellect
0:02.081 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, thorns, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.013 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, thorns, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.947 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, thorns, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, strife, battle_potion_of_intellect
0:04.881 default I celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, thorns, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, strife, battle_potion_of_intellect
0:05.692 default F berserking Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, thorns, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, strife, battle_potion_of_intellect
0:05.692 default G use_items Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, thorns, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, strife, battle_potion_of_intellect
0:05.692 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, thorns, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, strife, battle_potion_of_intellect, ignition_mages_fuse
0:06.446 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, berserking, thorns, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), strife, battle_potion_of_intellect, ignition_mages_fuse
0:07.200 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, berserking, thorns, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(24), strife, battle_potion_of_intellect, ignition_mages_fuse
0:07.954 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, berserking, thorns, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(24), conch_of_dark_whispers, strife, battle_potion_of_intellect, ignition_mages_fuse
0:08.709 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, berserking, thorns, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(23), conch_of_dark_whispers, strife, battle_potion_of_intellect, ignition_mages_fuse
0:09.495 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, berserking, thorns, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(22), conch_of_dark_whispers, strife, battle_potion_of_intellect, ignition_mages_fuse
0:10.251 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, berserking, thorns, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(21), conch_of_dark_whispers, strife, battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.005 default R solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power bloodlust, berserking, thorns, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(20), conch_of_dark_whispers, strife(2), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.759 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, berserking, thorns, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(20), conch_of_dark_whispers, strife(2), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.526 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(19), conch_of_dark_whispers, strife(2), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.282 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(18), conch_of_dark_whispers, strife(2), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.036 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(17), conch_of_dark_whispers, strife(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.789 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(17), conch_of_dark_whispers, strife(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.543 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(16), conch_of_dark_whispers, strife(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.296 default N sunfire Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(15), conch_of_dark_whispers, strife(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.051 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(14), conch_of_dark_whispers, strife(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.806 default O moonfire Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(14), conch_of_dark_whispers, strife(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.559 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(13), conch_of_dark_whispers, strife(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.315 default Q lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(12), conch_of_dark_whispers, strife(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.119 default R solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(11), conch_of_dark_whispers, strife(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.873 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, overwhelming_power(11), conch_of_dark_whispers, strife(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.627 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(10), conch_of_dark_whispers, strife(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.382 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(9), conch_of_dark_whispers, strife(5), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.136 default P stellar_flare Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(8), strife(5), ignition_mages_fuse(5)
0:23.891 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(8), strife(6), ignition_mages_fuse(5)
0:24.644 default L sunfire Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(7), strife(6), ignition_mages_fuse(5)
0:25.396 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(6), strife(6), ignition_mages_fuse(5)
0:26.331 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(5), strife(6)
0:27.220 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(4), strife(7)
0:28.327 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(3), strife(7)
0:29.436 default Q lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(2), strife(7)
0:30.551 default R solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power, strife(7)
0:31.305 default R solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, strife(7)
0:32.187 default R solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(24), strife(7)
0:32.995 default R solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(24), strife(7)
0:33.806 default R solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(23), strife(7)
0:34.616 default K starsurge Fluffy_Pillow 96.0/100: 96% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(22), strife(7)
0:35.430 default R solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21), strife(7)
0:36.184 default Q lunar_strike Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25), conch_of_dark_whispers, strife(7)
0:37.078 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power bloodlust, celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(24), conch_of_dark_whispers, strife(7)
0:37.833 default R solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), conch_of_dark_whispers, strife(8)
0:38.589 default Q lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(23), conch_of_dark_whispers, strife(8)
0:39.488 default R solar_wrath Fluffy_Pillow 75.0/100: 75% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(22), conch_of_dark_whispers, strife(8)
0:40.243 default S sunfire Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, arcanic_pulsar, celestial_alignment, starlord(3), overwhelming_power(21), conch_of_dark_whispers, strife(8)
0:40.997 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, arcanic_pulsar, celestial_alignment, overwhelming_power(21), conch_of_dark_whispers, strife(8)
0:41.774 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(20), conch_of_dark_whispers, strife(8)
0:42.901 default O moonfire Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(19), conch_of_dark_whispers, strife(8)
0:44.001 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(17), conch_of_dark_whispers, strife(8)
0:45.411 default H thorns Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(16), conch_of_dark_whispers, strife(8)
0:46.163 default P stellar_flare Fluffy_Pillow 33.5/100: 34% astral_power thorns, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(15), conch_of_dark_whispers, strife(8)
0:47.277 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power thorns, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(14), conch_of_dark_whispers, strife(8)
0:48.395 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power thorns, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(13), conch_of_dark_whispers, strife(8)
0:49.324 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power thorns, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(12), conch_of_dark_whispers, strife(8)
0:50.722 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power thorns, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(11), strife(8)
0:51.656 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power thorns, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(10), strife(8)
0:53.061 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power thorns, arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(8), strife(8)
0:54.174 default R solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power thorns, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(7), strife(8)
0:55.123 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power thorns, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(6), strife(8)
0:56.550 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power thorns, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(5), strife(8)
0:57.982 default R solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(4), strife(8)
0:58.942 default N sunfire Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(3), strife(8)
1:00.074 default R solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power, strife(8)
1:01.046 default K starsurge Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, torrent_of_elements, strife(8)
1:02.295 default O moonfire Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, strife(8)
1:03.508 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, strife(8)
1:05.054 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, strife(8)
1:06.267 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, strife(8)
1:07.270 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, strife(8)
1:08.770 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, strife(8)
1:09.772 default P stellar_flare Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, strife(8)
1:10.950 default Q lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, strife(8)
1:12.451 default R solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), strife(8)
1:13.455 default K starsurge Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), strife(8)
1:14.632 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), strife(8)
1:15.604 default Q lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), strife(8)
1:17.062 default N sunfire Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), strife(8)
1:18.210 default Q lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), strife(8)
1:19.670 default R solar_wrath Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), strife(8)
1:20.644 default R solar_wrath Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), strife(8)
1:21.617 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power arcanic_pulsar(8), strife(8)
1:22.867 default R solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, strife(8)
1:23.764 default K starsurge Fluffy_Pillow 75.5/100: 76% astral_power celestial_alignment, lunar_empowerment, starlord, strife(8)
1:24.818 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), strife(8)
1:25.690 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), strife(8)
1:26.715 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), strife(8)
1:27.563 default M moonfire Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), strife(8)
1:28.559 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3), strife(8)
1:30.020 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), strife(8)
1:31.481 default H thorns Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), strife(8)
1:32.248 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power thorns, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), strife(8)
1:33.393 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power thorns, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), strife(8)
1:34.853 default N sunfire Fluffy_Pillow 18.0/100: 18% astral_power thorns, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), strife(8)
1:35.999 default P stellar_flare Fluffy_Pillow 21.5/100: 22% astral_power thorns, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), strife(8)
1:37.145 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power thorns, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), strife(8)
1:38.117 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power thorns, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), strife(8)
1:39.577 default R solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power thorns, arcanic_pulsar(3), solar_empowerment(2), starlord(3), strife(8)
1:40.551 default R solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power thorns, arcanic_pulsar(3), solar_empowerment, starlord(3), strife(8)
1:41.522 default Q lunar_strike Fluffy_Pillow 73.5/100: 74% astral_power thorns, arcanic_pulsar(3), lunar_empowerment, starlord(3), strife(8)
1:42.980 default K starsurge Fluffy_Pillow 86.5/100: 87% astral_power thorns, arcanic_pulsar(3), strife(8)
1:44.228 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, strife(8)
1:45.440 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), strife(8)
1:46.941 default O moonfire Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), strife(8)
1:48.117 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), strife(8)
1:49.119 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), strife(8)
1:50.296 default R solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), strife(8)
1:51.270 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), strife(8)
1:52.730 default N sunfire Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), strife(8)
1:53.875 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), strife(8)
1:54.847 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), strife(8)
1:55.992 default R solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), strife(8)
1:56.964 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), strife(8)
1:58.423 default P stellar_flare Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), strife(8)
1:59.569 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), strife(8)
2:01.029 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), strife(8)
2:02.002 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), strife(8)
2:02.976 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(7), starlord(3), strife(8)
2:04.121 default K starsurge Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(7), strife(8)
2:05.371 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, strife(8)
2:06.916 default G use_items Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(8), solar_empowerment, starlord, strife(8)
2:06.916 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(8), solar_empowerment, starlord, strife(8), ignition_mages_fuse
2:08.080 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(24), strife(8), ignition_mages_fuse
2:08.850 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(24), strife(8), ignition_mages_fuse
2:10.002 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power celestial_alignment, solar_empowerment, starlord(2), overwhelming_power(22), strife(8), ignition_mages_fuse
2:10.913 default R solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), strife(8), ignition_mages_fuse
2:11.667 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(21), strife(8), ignition_mages_fuse(2)
2:12.759 default M moonfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(20), strife(8), ignition_mages_fuse(2)
2:13.618 default N sunfire Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(19), strife(8), ignition_mages_fuse(2)
2:14.607 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(18), strife(8), ignition_mages_fuse(2)
2:15.451 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(17), strife(8), ignition_mages_fuse(3)
2:16.414 default H thorns Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(16), strife(8), ignition_mages_fuse(3)
2:17.234 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power thorns, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(15), strife(8), ignition_mages_fuse(3)
2:18.467 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power thorns, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(14), strife(8), ignition_mages_fuse(3)
2:19.704 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power thorns, arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(13), strife(8), ignition_mages_fuse(4)
2:20.505 default R solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power thorns, arcanic_pulsar(2), starlord(3), overwhelming_power(12), strife(8), ignition_mages_fuse(4)
2:21.447 default R solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power thorns, arcanic_pulsar(2), starlord(3), overwhelming_power(11), strife(8), ignition_mages_fuse(4)
2:22.393 default P stellar_flare Fluffy_Pillow 64.5/100: 65% astral_power thorns, arcanic_pulsar(2), starlord(3), overwhelming_power(10), strife(8), ignition_mages_fuse(4)
2:23.341 default R solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power thorns, arcanic_pulsar(2), starlord(3), overwhelming_power(9), strife(8), ignition_mages_fuse(5)
2:24.261 default K starsurge Fluffy_Pillow 86.0/100: 86% astral_power thorns, arcanic_pulsar(2), overwhelming_power(8), strife(8), ignition_mages_fuse(5)
2:25.268 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power thorns, arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(7), strife(8), ignition_mages_fuse(5)
2:26.248 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power thorns, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(6), strife(8), ignition_mages_fuse(5)
2:27.464 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power thorns, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(5), conch_of_dark_whispers, strife(8)
2:28.936 default N sunfire Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(4), conch_of_dark_whispers, strife(8)
2:30.098 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(2), conch_of_dark_whispers, strife(8)
2:31.268 default O moonfire Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power, conch_of_dark_whispers, strife(8)
2:32.408 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(8)
2:33.382 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(8)
2:34.841 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(8)
2:35.814 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(8)
2:36.787 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(8)
2:37.933 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(8)
2:39.392 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(8)
2:40.367 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(8)
2:41.340 default R solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(8)
2:42.312 default Q lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), conch_of_dark_whispers, strife(8)
2:43.772 default R solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(6), starlord(3), strife(8)
2:44.918 default K starsurge Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(6), lunar_empowerment, strife(8)
2:46.166 default P stellar_flare Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord, strife(8)
2:47.378 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord, strife(8)
2:48.591 default N sunfire Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(2), strife(8)
2:49.769 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(2), strife(8)
2:51.269 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), strife(8)
2:52.768 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), strife(8)
2:53.946 default O moonfire Fluffy_Pillow 14.5/100: 14% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), strife(8)
2:54.942 default R solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), strife(8)
2:55.789 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), strife(8)
2:57.057 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), strife(8)
2:58.053 default R solar_wrath Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), strife(8)
2:58.901 default L sunfire Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), strife(8)
2:59.900 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment(2), starlord(3), strife(8)
3:01.360 default H thorns Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers, strife(8)
3:02.246 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power thorns, arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers, strife(8)
3:03.709 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power thorns, arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, strife(8)
3:05.169 default I celestial_alignment Fluffy_Pillow 56.0/100: 56% astral_power thorns, arcanic_pulsar, celestial_alignment, solar_empowerment(2), conch_of_dark_whispers, strife(8)
3:06.255 default E potion Fluffy_Pillow 97.0/100: 97% astral_power thorns, arcanic_pulsar, celestial_alignment, solar_empowerment(2), torrent_of_elements, conch_of_dark_whispers, strife(8)
3:06.255 default F berserking Fluffy_Pillow 97.0/100: 97% astral_power thorns, arcanic_pulsar, celestial_alignment, solar_empowerment(2), torrent_of_elements, conch_of_dark_whispers, strife(8), battle_potion_of_intellect
3:06.255 default K starsurge Fluffy_Pillow 97.0/100: 97% astral_power berserking, thorns, arcanic_pulsar, celestial_alignment, solar_empowerment(2), torrent_of_elements, conch_of_dark_whispers, strife(8), battle_potion_of_intellect
3:07.243 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power berserking, thorns, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, conch_of_dark_whispers, strife(8), battle_potion_of_intellect
3:08.059 default K starsurge Fluffy_Pillow 70.0/100: 70% astral_power berserking, thorns, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers, strife(8), battle_potion_of_intellect
3:09.018 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power berserking, thorns, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, conch_of_dark_whispers, strife(8), battle_potion_of_intellect
3:09.809 default P stellar_flare Fluffy_Pillow 43.5/100: 44% astral_power berserking, thorns, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers, strife(8), battle_potion_of_intellect
3:10.742 default R solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power berserking, thorns, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers, strife(8), battle_potion_of_intellect
3:11.535 default K starsurge Fluffy_Pillow 64.5/100: 65% astral_power berserking, thorns, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers, strife(8), battle_potion_of_intellect
3:12.468 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power berserking, thorns, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(8), battle_potion_of_intellect
3:13.238 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power berserking, thorns, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25), conch_of_dark_whispers, strife(8), battle_potion_of_intellect
3:14.294 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers, strife(8), battle_potion_of_intellect
3:15.124 default O moonfire Fluffy_Pillow 7.0/100: 7% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers, strife(8), battle_potion_of_intellect
3:15.959 default R solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), strife(8), battle_potion_of_intellect
3:16.713 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), strife(8), battle_potion_of_intellect
3:17.779 default N sunfire Fluffy_Pillow 35.5/100: 36% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21), strife(8), battle_potion_of_intellect
3:18.619 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20), strife(8), battle_potion_of_intellect
3:19.545 default R solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), strife(8), battle_potion_of_intellect
3:20.336 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(18), strife(8), battle_potion_of_intellect
3:21.526 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(17), strife(8), battle_potion_of_intellect
3:22.323 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(16), strife(8), battle_potion_of_intellect
3:23.520 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(15), strife(8), battle_potion_of_intellect
3:24.323 default L sunfire Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(14), strife(8), battle_potion_of_intellect
3:25.270 default Q lunar_strike Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(6), lunar_empowerment(3), starlord(3), overwhelming_power(13), strife(8), battle_potion_of_intellect
3:26.662 default K starsurge Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(6), lunar_empowerment(2), overwhelming_power(12), strife(8), battle_potion_of_intellect
3:27.857 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord, overwhelming_power(11), strife(8), battle_potion_of_intellect
3:29.339 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(9), strife(8), battle_potion_of_intellect
3:30.513 default Q lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(8), strife(8), battle_potion_of_intellect
3:31.969 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(7), strife(8)
3:33.430 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(5), strife(8)
3:34.414 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(4), strife(8)
3:35.575 default P stellar_flare Fluffy_Pillow 17.5/100: 18% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(3), strife(8)
3:36.561 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(2), strife(8)
3:37.404 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power, strife(8)
3:38.668 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), strife(8)
3:39.666 default R solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(25), strife(8)
3:40.442 default M moonfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24), strife(8)
3:41.357 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23), strife(8)
3:42.701 default N sunfire Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), strife(8)
3:43.759 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(25), strife(8)
3:45.090 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(23), strife(8)
3:45.985 default R solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(23), strife(8)
3:46.881 default H thorns Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar, overwhelming_power(22), strife(8)
3:47.652 default K starsurge Fluffy_Pillow 67.5/100: 68% astral_power thorns, arcanic_pulsar, overwhelming_power(21), strife(8)
3:48.809 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power thorns, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(25), strife(8)
3:50.219 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power thorns, arcanic_pulsar(2), solar_empowerment, starlord, overwhelming_power(23), strife(8)
3:51.334 default Q lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power thorns, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(22), strife(8)
3:52.719 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power thorns, arcanic_pulsar(3), solar_empowerment(2), starlord(2), overwhelming_power(21), strife(8)
3:53.646 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power thorns, arcanic_pulsar(3), solar_empowerment, starlord(2), overwhelming_power(20), strife(8)
3:54.574 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power thorns, arcanic_pulsar(3), starlord(2), overwhelming_power(19), strife(8)
3:55.672 default Q lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power thorns, arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(18), strife(8)
3:57.039 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power thorns, arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(16), strife(8)
3:57.958 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power thorns, arcanic_pulsar(4), lunar_empowerment, starlord(3), overwhelming_power(16), strife(8)
3:59.039 default P stellar_flare Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(4), lunar_empowerment, starlord(3), overwhelming_power(14), strife(8)
4:00.127 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(4), lunar_empowerment, starlord(3), overwhelming_power(13), strife(8)
4:01.519 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(12), strife(8)
4:02.617 default N sunfire Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(11), strife(8)
4:03.717 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(10), strife(8)
4:05.123 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(8)
4:06.069 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(7), strife
4:07.491 default G use_items Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(6), strife
4:07.491 default R solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(6), strife, ignition_mages_fuse
4:08.407 default K starsurge Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(5), solar_empowerment, overwhelming_power(5), strife, ignition_mages_fuse
4:09.584 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(4), strife(2), ignition_mages_fuse
4:11.044 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord, overwhelming_power(2), strife(2), ignition_mages_fuse
4:12.198 default R solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power, strife(2), ignition_mages_fuse(2)
4:13.118 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), strife(2), ignition_mages_fuse(2)
4:14.501 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), strife(2), ignition_mages_fuse(2)
4:15.884 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), strife(2), ignition_mages_fuse(3)
4:16.930 default R solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), strife(2), ignition_mages_fuse(3)
4:17.794 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), strife(2), ignition_mages_fuse(3)
4:19.087 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), strife(2), ignition_mages_fuse(3)
4:19.952 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), strife(2), ignition_mages_fuse(4)
4:20.786 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), strife(2), ignition_mages_fuse(4)
4:22.033 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(8), starlord(3), strife(3), ignition_mages_fuse(4)
4:23.012 default K starsurge Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(8), starlord(3), strife(3), ignition_mages_fuse(4)
4:23.992 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), strife(3), ignition_mages_fuse(5)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="conflict+strife"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/thorns
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

crucible of flame : 37167 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
37166.5 37166.5 26.0 / 0.070% 4506.1 / 12.1% 4693.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
7.9 7.8 Astral Power 0.00% 57.9 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
crucible of flame 37167
Ancient Flame 1260 3.4% 24.9 11.73sec 15141 0 Periodic 90.0 3557 7117 4198 18.0% 57.9%

Stats details: ancient_flame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.95 0.00 89.97 89.97 0.0000 1.9319 377709.05 377709.05 0.00 2173.06 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.8 82.00% 3557.38 2 6423 3536.23 1997 5030 262451 262451 0.00
crit 16.2 18.00% 7116.74 4 12846 7070.09 3586 11259 115258 115258 0.00
 
 

Action details: ancient_flame

Static Values
  • id:295367
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295367
  • name:Ancient Flame
  • school:fire
  • tooltip:Suffering $w1 fire damage every $t1 sec.
  • description:{$@spelldesc295365=Your spells and abilities have a chance to cauterize your target for ${$m3*5} Fire damage over {$295367d=10 seconds} or healing an ally for ${$m3*5} over {$295367d=10 seconds}$?a295369[, stacking up to {$295367u=1} times][].}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:1313.31
  • base_td_mult:1.35
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Concentrated Flame 0 (1881) 0.0% (5.1%) 11.5 29.91sec 49029 45334

Stats details: concentrated_flame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.49 0.00 0.00 0.00 1.0816 0.0000 0.00 0.00 0.00 45333.86 45333.86
 
 

Action details: concentrated_flame

Static Values
  • id:295373
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295373
  • name:Concentrated Flame
  • school:fire
  • tooltip:
  • description:Blast your target with a ball of concentrated flame, dealing ${{$295365s2=3369}*(1+$@versadmg)} Fire damage to an enemy or healing an ally for ${{$295365s2=3369}*(1+$@versadmg)}$?a295377[, then burn the target for an additional $295377m1% of the damage or healing done over {$295368d=6 seconds}][]. Each cast of Concentrated Flame deals {$s3=100}% increased damage or healing. This bonus resets after every third cast.
 
    Concentrated Flame (_missile) 1139 3.1% 11.5 29.91sec 29694 0 Direct 11.5 25165 50742 29693 17.7%  

Stats details: concentrated_flame_missile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.49 11.49 0.00 0.00 0.0000 0.0000 341276.15 341276.15 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.46 82.29% 25165.28 12753 42084 25139.99 17641 36027 238024 238024 0.00
crit 2.03 17.71% 50741.83 25506 84168 45088.22 0 84168 103252 103252 0.00
 
 

Action details: concentrated_flame_missile

Static Values
  • id:295374
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295374
  • name:Concentrated Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc295373=Blast your target with a ball of concentrated flame, dealing ${{$295365s2=3369}*(1+$@versadmg)} Fire damage to an enemy or healing an ally for ${{$295365s2=3369}*(1+$@versadmg)}$?a295377[, then burn the target for an additional $295377m1% of the damage or healing done over {$295368d=6 seconds}][]. Each cast of Concentrated Flame deals {$s3=100}% increased damage or healing. This bonus resets after every third cast.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11614.19
  • base_dd_max:11614.19
  • base_dd_mult:1.00
 
    Concentrated Flame (_burn) 741 2.0% 11.5 29.91sec 19335 0 Periodic 32.1 6932 0 6932 0.0% 21.4%

Stats details: concentrated_flame_burn

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.49 0.00 32.06 32.06 0.0000 2.0000 222223.69 222223.69 0.00 3466.02 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.1 100.00% 6931.93 3347 11047 6930.06 6695 7579 222224 222224 0.00
 
 

Action details: concentrated_flame_burn

Static Values
  • id:295368
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295368
  • name:Concentrated Flame
  • school:fire
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:{$@spelldesc295373=Blast your target with a ball of concentrated flame, dealing ${{$295365s2=3369}*(1+$@versadmg)} Fire damage to an enemy or healing an ally for ${{$295365s2=3369}*(1+$@versadmg)}$?a295377[, then burn the target for an additional $295377m1% of the damage or healing done over {$295368d=6 seconds}][]. Each cast of Concentrated Flame deals {$s3=100}% increased damage or healing. This bonus resets after every third cast.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:3507.02
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Heed My Call 291 (415) 0.8% (1.1%) 8.1 33.68sec 15364 0 Direct 8.1 9113 18219 10764 18.1%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.10 8.10 0.00 0.00 0.0000 0.0000 87204.35 87204.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.63 81.87% 9112.73 8901 9791 9108.41 0 9791 60443 60443 0.00
crit 1.47 18.13% 18219.43 17802 19582 14165.33 0 19582 26761 26761 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 124 0.3% 8.1 33.68sec 4600 0 Direct 8.1 3905 7814 4601 17.8%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.10 8.10 0.00 0.00 0.0000 0.0000 37271.90 37271.90 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.66 82.20% 3904.79 3815 4196 3902.69 0 4196 26006 26006 0.00
crit 1.44 17.80% 7814.42 7629 8392 6001.94 0 8392 11266 11266 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 4841 13.0% 74.1 3.93sec 19572 14967 Direct 74.1 16599 33187 19572 17.9%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.11 74.11 0.00 0.00 1.3077 0.0000 1450446.42 1450446.42 0.00 14967.10 14967.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.82 82.07% 16598.67 8882 21253 16605.96 15961 17416 1009570 1009570 0.00
crit 13.28 17.93% 33186.53 17765 42507 33199.58 29908 38482 440877 440877 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2431 6.5% 14.1 21.26sec 51764 50161 Direct 14.1 2849 5700 3359 17.9%  
Periodic 219.8 2626 5248 3098 18.0% 98.6%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.07 14.07 219.80 219.80 1.0320 1.3452 728092.13 728092.13 0.00 2347.24 50161.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.55 82.11% 2848.64 2589 3565 2850.17 2609 3105 32900 32900 0.00
crit 2.52 17.89% 5699.58 5177 7129 5329.39 0 7129 14340 14340 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.3 82.01% 2625.84 2 3319 2627.10 2557 2748 473343 473343 0.00
crit 39.5 17.99% 5248.25 6 6638 5250.54 4887 5669 207508 207508 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 787 2.1% 43.8 6.62sec 5378 0 Direct 43.8 4557 9111 5378 18.0%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.82 43.82 0.00 0.00 0.0000 0.0000 235652.81 235652.81 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.92 81.97% 4556.56 4180 5756 4558.79 4258 5002 163670 163670 0.00
crit 7.90 18.03% 9110.93 8360 11513 9109.77 0 11513 71982 71982 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2687 (4264) 7.2% (11.5%) 88.8 3.30sec 14392 15952 Direct 89.3 7645 15276 9013 17.9%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.77 89.31 0.00 0.00 0.9022 0.0000 804976.32 804976.32 0.00 15952.19 15952.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.30 82.07% 7644.90 6967 9594 7649.69 7393 8150 560353 560353 0.00
crit 16.01 17.93% 15276.45 13933 19188 15287.30 13933 17103 244623 244623 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1578 4.2% 71.6 4.07sec 6599 0 Direct 71.6 6599 0 6599 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.63 71.63 0.00 0.00 0.0000 0.0000 472650.36 472650.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.63 100.00% 6598.74 5086 14007 6602.17 5744 7868 472650 472650 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5594.17
  • base_dd_max:5594.17
  • base_dd_mult:1.00
 
Starsurge 11450 30.8% 59.3 5.07sec 57865 54967 Direct 59.1 49253 98428 58049 17.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.25 59.06 0.00 0.00 1.0527 0.0000 3428512.35 3428512.35 0.00 54967.01 54967.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.50 82.11% 49252.81 45067 61614 49277.82 47388 52359 2388623 2388623 0.00
crit 10.56 17.89% 98428.41 90135 123227 98465.69 90135 123227 1039890 1039890 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1576 4.2% 12.7 23.57sec 37175 35584 Direct 12.7 2369 4734 2790 17.8%  
Periodic 217.5 1702 3403 2008 18.0% 97.8%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.70 12.70 217.46 217.46 1.0448 1.3484 472053.99 472053.99 0.00 1540.16 35583.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.44 82.19% 2369.11 2231 3073 2370.25 2231 2562 24726 24726 0.00
crit 2.26 17.81% 4734.20 4463 6146 4315.49 0 6146 10707 10707 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 178.4 82.02% 1702.09 3 2151 1702.92 1653 1785 303601 303601 0.00
crit 39.1 17.98% 3402.82 4 4302 3404.35 3196 3738 133020 133020 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5558 14.9% 85.8 3.23sec 19287 0 Direct 85.8 16359 32727 19287 17.9%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.81 85.81 0.00 0.00 0.0000 0.0000 1654951.53 1654951.53 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.46 82.11% 16359.02 15985 17583 16358.72 15985 17246 1152602 1152602 0.00
crit 15.35 17.89% 32727.46 31970 35167 32726.93 31970 34847 502350 502350 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2704 7.3% 17.7 16.77sec 45738 44568 Direct 17.7 3907 7806 4608 18.0%  
Periodic 219.0 2821 5637 3327 18.0% 98.3%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.71 17.71 218.96 218.96 1.0263 1.3467 810162.41 810162.41 0.00 2587.96 44568.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.53 82.04% 3907.08 3570 4917 3907.93 3645 4209 56776 56776 0.00
crit 3.18 17.96% 7806.35 7141 9834 7574.47 0 9834 24837 24837 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 179.6 82.02% 2820.99 5 3565 2822.32 2739 2950 506641 506641 0.00
crit 39.4 17.98% 5636.95 29 7129 5639.78 5272 6078 221909 221909 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
crucible of flame
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:crucible of flame
  • harmful:false
  • if_expr:
 
Berserking 2.0 181.46sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 185.48sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8741 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:crucible of flame
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:crucible of flame
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.0 52.0 45.4sec 5.1sec 92.70% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:10.78%
  • arcanic_pulsar_2:10.60%
  • arcanic_pulsar_3:11.57%
  • arcanic_pulsar_4:10.59%
  • arcanic_pulsar_5:13.42%
  • arcanic_pulsar_6:9.78%
  • arcanic_pulsar_7:11.02%
  • arcanic_pulsar_8:14.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 192.4sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 181.5sec 181.5sec 8.11% 8.24% 0.0(0.0) 2.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.1 0.0 38.2sec 38.2sec 25.55% 32.29% 0.0(0.0) 8.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.8sec 45.2sec 23.71% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.11% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.92%
  • ignition_mages_fuse_2:3.87%
  • ignition_mages_fuse_3:3.82%
  • ignition_mages_fuse_4:3.77%
  • ignition_mages_fuse_5:3.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 31.9 45.3 9.5sec 3.9sec 82.29% 99.72% 2.0(2.0) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.32%
  • lunar_empowerment_2:31.83%
  • lunar_empowerment_3:15.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.5 3.4 64.5sec 34.1sec 47.55% 0.00% 3.4(46.9) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.66%
  • overwhelming_power_9:1.71%
  • overwhelming_power_10:1.75%
  • overwhelming_power_11:1.80%
  • overwhelming_power_12:1.86%
  • overwhelming_power_13:1.91%
  • overwhelming_power_14:1.97%
  • overwhelming_power_15:2.02%
  • overwhelming_power_16:2.08%
  • overwhelming_power_17:2.14%
  • overwhelming_power_18:2.20%
  • overwhelming_power_19:2.27%
  • overwhelming_power_20:2.34%
  • overwhelming_power_21:2.41%
  • overwhelming_power_22:2.48%
  • overwhelming_power_23:2.56%
  • overwhelming_power_24:2.63%
  • overwhelming_power_25:1.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 23.6 50.4 12.4sec 4.1sec 85.90% 80.35% 0.3(0.3) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:27.83%
  • solar_empowerment_2:39.96%
  • solar_empowerment_3:18.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.1 44.1 20.3sec 5.1sec 96.82% 92.13% 14.3(14.3) 11.4

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.84%
  • starlord_2:23.08%
  • starlord_3:58.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.8sec 45.5sec 23.70% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.70%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
crucible of flame
starsurge Astral Power 59.3 2370.0 40.0 40.0 1446.6
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 89.77 718.12 (30.78%) 8.00 0.06 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.43%) 40.00 0.00 0.00%
sunfire Astral Power 17.71 53.14 (2.28%) 3.00 0.00 0.00%
shooting_stars Astral Power 43.82 175.27 (7.51%) 4.00 0.01 0.01%
moonfire Astral Power 14.07 42.20 (1.81%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.70 101.59 (4.35%) 8.00 0.00 0.00%
lunar_strike Astral Power 74.11 889.21 (38.12%) 12.00 0.07 0.01%
natures_balance Astral Power 400.43 200.21 (8.58%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.09 73.10 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.78 7.90
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.06 0.00 75.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data crucible of flame Fight Length
Count 7600
Mean 299.94
Minimum 240.00
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data crucible of flame Damage Per Second
Count 7600
Mean 37166.54
Minimum 33929.59
Maximum 41640.90
Spread ( max - min ) 7711.32
Range [ ( max - min ) / 2 * 100% ] 10.37%
Standard Deviation 1154.9419
5th Percentile 35360.09
95th Percentile 39133.89
( 95th Percentile - 5th Percentile ) 3773.81
Mean Distribution
Standard Deviation 13.2481
95.00% Confidence Intervall ( 37140.58 - 37192.51 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3710
0.1 Scale Factor Error with Delta=300 11387
0.05 Scale Factor Error with Delta=300 45548
0.01 Scale Factor Error with Delta=300 1138686
Priority Target DPS
Sample Data crucible of flame Priority Target Damage Per Second
Count 7600
Mean 37166.54
Minimum 33929.59
Maximum 41640.90
Spread ( max - min ) 7711.32
Range [ ( max - min ) / 2 * 100% ] 10.37%
Standard Deviation 1154.9419
5th Percentile 35360.09
95th Percentile 39133.89
( 95th Percentile - 5th Percentile ) 3773.81
Mean Distribution
Standard Deviation 13.2481
95.00% Confidence Intervall ( 37140.58 - 37192.51 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3710
0.1 Scale Factor Error with Delta=300 11387
0.05 Scale Factor Error with Delta=300 45548
0.01 Scale Factor Error with Delta=300 1138686
DPS(e)
Sample Data crucible of flame Damage Per Second (Effective)
Count 7600
Mean 37166.54
Minimum 33929.59
Maximum 41640.90
Spread ( max - min ) 7711.32
Range [ ( max - min ) / 2 * 100% ] 10.37%
Damage
Sample Data crucible of flame Damage
Count 7600
Mean 11123183.47
Minimum 8595816.25
Maximum 13819197.85
Spread ( max - min ) 5223381.61
Range [ ( max - min ) / 2 * 100% ] 23.48%
DTPS
Sample Data crucible of flame Damage Taken Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data crucible of flame Healing Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data crucible of flame Healing Per Second (Effective)
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data crucible of flame Heal
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data crucible of flame Healing Taken Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data crucible of flame Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data crucible of flameTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data crucible of flame Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.94 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
H 11.49 concentrated_flame
0.00 thorns
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.74 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 59.25 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.95 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.62 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.47 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.45 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.70 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 74.46 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 89.01 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.30 sunfire

Sample Sequence

0123456789ACDHHKONPIFGKRKRQRKRQRQKRNRQORQRSKPKRLKQQQHRQRRRKRQKRQRJKONQKPQQRKRQQRRHJKKNOQQKRPQKRQQRRNKRKRQRKOHQQQKPNQRRKQQKORQRKQQNRPHQRKKRQGQORKRQRKRQKNRQRRPKQRKQRHONKRQRQQRRRKKQPRKNROQQRQRHJKRKRQKFLQQIEKPRQKORQRQJKRKRQKNRQKHQQQPORRRKRKRQKLQQKRQQRRQOHKKNPQGQKRQRKRQRQRQRQKK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask crucible of flame 58.0/100: 58% astral_power
Pre precombat 1 food crucible of flame 58.0/100: 58% astral_power
Pre precombat 2 augmentation crucible of flame 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H concentrated_flame Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.248 default H concentrated_flame Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, battle_potion_of_intellect
0:02.209 default K starsurge Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, battle_potion_of_intellect
0:03.171 default O moonfire Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.108 default N sunfire Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.044 default P stellar_flare Fluffy_Pillow 35.0/100: 35% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.978 default I celestial_alignment Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:06.790 default F berserking Fluffy_Pillow 84.5/100: 85% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:06.790 default G use_items Fluffy_Pillow 84.5/100: 85% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:06.790 default K starsurge Fluffy_Pillow 84.5/100: 85% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:07.546 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.301 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.056 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.811 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:10.663 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:11.419 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.174 default R solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.927 default Q lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.748 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.503 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.322 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.076 default R solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.833 default N sunfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(25), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.588 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.343 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.096 default O moonfire Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.850 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.605 default Q lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.388 default R solar_wrath Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.143 default S sunfire Fluffy_Pillow 84.5/100: 85% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.897 default K starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, torrent_of_elements, overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.651 default P stellar_flare Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(18), ignition_mages_fuse(5)
0:24.406 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(17), ignition_mages_fuse(5)
0:25.160 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(16), ignition_mages_fuse(5)
0:25.915 default L sunfire Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(16), ignition_mages_fuse(5)
0:26.671 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(15), ignition_mages_fuse(5)
0:27.425 default Q lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(14)
0:28.493 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(13)
0:29.564 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12)
0:30.640 default H concentrated_flame Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(11)
0:31.488 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(10)
0:32.241 default Q lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(9)
0:33.327 default R solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(8)
0:34.082 default R solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(7)
0:34.942 default R solar_wrath Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(7)
0:35.802 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(6)
0:36.666 default R solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(5)
0:37.421 default Q lunar_strike Fluffy_Pillow 80.5/100: 81% astral_power bloodlust, celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(4)
0:38.384 default K starsurge Fluffy_Pillow 97.5/100: 98% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(3)
0:39.144 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(2)
0:39.897 default Q lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(2)
0:40.867 default R solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power
0:41.631 default J cancel_buff Fluffy_Pillow 91.5/100: 92% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3)
0:41.631 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2)
0:42.717 default O moonfire Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord
0:43.928 default N sunfire Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord
0:45.141 default Q lunar_strike Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord
0:46.685 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord
0:47.898 default P stellar_flare Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2)
0:49.076 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2)
0:50.576 default Q lunar_strike Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2)
0:52.078 default R solar_wrath Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(2)
0:53.080 default K starsurge Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2)
0:54.259 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:55.232 default Q lunar_strike Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:56.691 default Q lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3)
0:58.150 default R solar_wrath Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3)
0:59.123 default R solar_wrath Fluffy_Pillow 85.0/100: 85% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3)
1:00.098 default H concentrated_flame Fluffy_Pillow 94.0/100: 94% astral_power arcanic_pulsar(4), lunar_empowerment, starlord(3)
1:01.244 default J cancel_buff Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar(4), lunar_empowerment, starlord(3)
1:01.244 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar(4), lunar_empowerment
1:02.491 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment, starlord
1:03.703 default N sunfire Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(2)
1:04.880 default O moonfire Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(2)
1:06.058 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(2)
1:07.558 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:09.058 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2)
1:10.235 default R solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:11.209 default P stellar_flare Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:12.356 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:13.815 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3)
1:14.962 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:15.935 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:17.395 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
1:18.853 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3)
1:19.826 default R solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3)
1:20.799 default N sunfire Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3)
1:21.943 default K starsurge Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(8), lunar_empowerment
1:23.190 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord
1:24.087 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power celestial_alignment, lunar_empowerment(2), starlord
1:25.142 default R solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2)
1:26.014 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2)
1:27.320 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2)
1:28.193 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2)
1:29.218 default O moonfire Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3)
1:30.364 default H concentrated_flame Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3)
1:31.510 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3)
1:32.969 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3)
1:34.428 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3)
1:35.888 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3)
1:37.034 default P stellar_flare Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
1:38.179 default N sunfire Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
1:39.324 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
1:40.783 default R solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(3)
1:41.758 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements
1:42.732 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, torrent_of_elements
1:43.979 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements
1:45.523 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements
1:47.067 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord, torrent_of_elements
1:48.280 default O moonfire Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements
1:49.459 default R solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements
1:50.462 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
1:51.962 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), torrent_of_elements
1:52.964 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements
1:54.143 default Q lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
1:55.603 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(25), conch_of_dark_whispers
1:56.936 default N sunfire Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), overwhelming_power(24), conch_of_dark_whispers
1:57.986 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), overwhelming_power(23), conch_of_dark_whispers
1:58.882 default P stellar_flare Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), conch_of_dark_whispers
1:59.940 default H concentrated_flame Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), conch_of_dark_whispers
2:01.066 default Q lunar_strike Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19), conch_of_dark_whispers
2:02.428 default R solar_wrath Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(25), conch_of_dark_whispers
2:03.318 default K starsurge Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(6), solar_empowerment, overwhelming_power(24), conch_of_dark_whispers
2:04.463 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(23), conch_of_dark_whispers
2:05.577 default R solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(22), conch_of_dark_whispers
2:06.501 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(21), conch_of_dark_whispers
2:07.891 default G use_items Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(20), conch_of_dark_whispers
2:07.891 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(20), conch_of_dark_whispers, ignition_mages_fuse
2:09.233 default O moonfire Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(2), overwhelming_power(18), ignition_mages_fuse
2:10.295 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(2), overwhelming_power(17), ignition_mages_fuse
2:11.198 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), overwhelming_power(16), ignition_mages_fuse
2:12.266 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(15), ignition_mages_fuse(2)
2:13.021 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14), ignition_mages_fuse(2)
2:14.135 default R solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power celestial_alignment, solar_empowerment(3), starlord(3), overwhelming_power(13), ignition_mages_fuse(2)
2:14.888 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(13), ignition_mages_fuse(2)
2:15.767 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(12), ignition_mages_fuse(2)
2:16.522 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(25), ignition_mages_fuse(3)
2:17.562 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(24), ignition_mages_fuse(3)
2:18.382 default N sunfire Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(23), ignition_mages_fuse(3)
2:19.328 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(22), ignition_mages_fuse(3)
2:20.134 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), ignition_mages_fuse(4)
2:21.302 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(2), solar_empowerment(3), starlord(3), overwhelming_power(20), ignition_mages_fuse(4)
2:22.084 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(19), ignition_mages_fuse(4)
2:22.871 default P stellar_flare Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(19), ignition_mages_fuse(4)
2:23.796 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(2), solar_empowerment, overwhelming_power(18), ignition_mages_fuse(4)
2:24.806 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(17), ignition_mages_fuse(5)
2:26.017 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, overwhelming_power(15), ignition_mages_fuse(5)
2:26.831 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(3), solar_empowerment, starlord, overwhelming_power(15), ignition_mages_fuse(5)
2:27.788 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(14), ignition_mages_fuse(5)
2:28.978 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(2), overwhelming_power(13)
2:29.934 default H concentrated_flame Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(12)
2:31.133 default O moonfire Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(10)
2:32.267 default N sunfire Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(9)
2:33.406 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(8)
2:34.551 default R solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(7)
2:35.502 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(6)
2:36.927 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(5)
2:37.883 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(4)
2:39.321 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(2)
2:40.771 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power
2:41.743 default R solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3)
2:42.716 default R solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(5), starlord(3)
2:43.860 default K starsurge Fluffy_Pillow 88.0/100: 88% astral_power arcanic_pulsar(5)
2:45.106 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord
2:46.319 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2)
2:47.819 default P stellar_flare Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2)
2:48.997 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2)
2:49.998 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
2:51.176 default N sunfire Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
2:52.323 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
2:53.297 default O moonfire Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24)
2:54.348 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23)
2:55.692 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22)
2:57.039 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20)
2:57.946 default Q lunar_strike Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20)
2:59.301 default R solar_wrath Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(18)
3:00.211 default H concentrated_flame Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(17)
3:01.286 default J cancel_buff Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(16)
3:01.286 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(8), lunar_empowerment, torrent_of_elements, overwhelming_power(16)
3:02.463 default R solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(15)
3:03.311 default K starsurge Fluffy_Pillow 71.0/100: 71% astral_power celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(14)
3:04.312 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(13)
3:05.144 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(12)
3:06.393 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(11)
3:07.379 default F berserking Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(10)
3:07.379 default L sunfire Fluffy_Pillow 13.5/100: 14% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(10)
3:08.251 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power berserking, arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(9)
3:09.536 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power berserking, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(8)
3:10.825 default I celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(7)
3:11.709 default E potion Fluffy_Pillow 83.5/100: 84% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(6)
3:11.709 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(6), battle_potion_of_intellect
3:12.597 default P stellar_flare Fluffy_Pillow 44.0/100: 44% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(5), battle_potion_of_intellect
3:13.487 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(4), battle_potion_of_intellect
3:14.245 default Q lunar_strike Fluffy_Pillow 65.0/100: 65% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(24), battle_potion_of_intellect
3:15.303 default K starsurge Fluffy_Pillow 82.0/100: 82% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(23), conch_of_dark_whispers, battle_potion_of_intellect
3:16.140 default O moonfire Fluffy_Pillow 42.5/100: 43% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect
3:16.977 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect
3:17.732 default Q lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(21), conch_of_dark_whispers, battle_potion_of_intellect
3:18.802 default R solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect
3:19.556 default Q lunar_strike Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers, battle_potion_of_intellect
3:20.723 default J cancel_buff Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect
3:20.723 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect
3:21.725 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers, battle_potion_of_intellect
3:22.557 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers, battle_potion_of_intellect
3:23.537 default R solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect
3:24.350 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers, battle_potion_of_intellect
3:25.573 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers, battle_potion_of_intellect
3:26.535 default N sunfire Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(16), conch_of_dark_whispers, battle_potion_of_intellect
3:27.475 default R solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(15), conch_of_dark_whispers, battle_potion_of_intellect
3:28.277 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers, battle_potion_of_intellect
3:29.482 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(13), battle_potion_of_intellect
3:30.431 default H concentrated_flame Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12), battle_potion_of_intellect
3:31.386 default Q lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(11), battle_potion_of_intellect
3:32.787 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10), battle_potion_of_intellect
3:34.193 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(8), battle_potion_of_intellect
3:35.611 default P stellar_flare Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(7), battle_potion_of_intellect
3:36.728 default O moonfire Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(6)
3:37.848 default R solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(5)
3:38.805 default R solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(4)
3:39.764 default R solar_wrath Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(3)
3:40.896 default K starsurge Fluffy_Pillow 88.0/100: 88% astral_power arcanic_pulsar(8), overwhelming_power(2)
3:42.136 default R solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
3:43.032 default K starsurge Fluffy_Pillow 69.5/100: 70% astral_power celestial_alignment, lunar_empowerment(2), starlord, conch_of_dark_whispers
3:44.088 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), conch_of_dark_whispers
3:44.960 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), conch_of_dark_whispers
3:46.266 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), conch_of_dark_whispers
3:47.293 default L sunfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers
3:48.289 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers
3:49.749 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
3:51.210 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
3:52.354 default R solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
3:53.327 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
3:54.785 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
3:56.245 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers
3:57.219 default R solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3)
3:58.191 default Q lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3)
3:59.652 default O moonfire Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar(3), starlord(3)
4:00.798 default H concentrated_flame Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar(3), starlord(3)
4:01.944 default K starsurge Fluffy_Pillow 88.0/100: 88% astral_power arcanic_pulsar(3)
4:03.193 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord
4:04.407 default N sunfire Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2)
4:05.584 default P stellar_flare Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(25)
4:06.661 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(24)
4:08.034 default G use_items Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(22)
4:08.034 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(22), ignition_mages_fuse
4:09.368 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(21), ignition_mages_fuse
4:10.419 default R solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(20), ignition_mages_fuse
4:11.291 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), ignition_mages_fuse
4:12.601 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(18), ignition_mages_fuse(2)
4:13.448 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17), ignition_mages_fuse(2)
4:14.447 default R solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(16), ignition_mages_fuse(2)
4:15.297 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15), ignition_mages_fuse(2)
4:16.577 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(14), ignition_mages_fuse(3)
4:17.402 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(13), ignition_mages_fuse(3)
4:18.643 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(12), ignition_mages_fuse(3)
4:19.474 default Q lunar_strike Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(11), ignition_mages_fuse(3)
4:20.725 default R solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(10), ignition_mages_fuse(4)
4:21.535 default Q lunar_strike Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(9), ignition_mages_fuse(4)
4:22.747 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(7), solar_empowerment(3), torrent_of_elements, overwhelming_power(8), ignition_mages_fuse(4)
4:23.787 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(7), ignition_mages_fuse(4)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="crucible of flame"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/thorns
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

focusing iris : 36685 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
36685.5 36685.5 25.3 / 0.069% 4343.7 / 11.8% 4301.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.5 8.4 Astral Power 0.00% 60.1 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
focusing iris 36685
Heed My Call 304 (434) 0.8% (1.2%) 8.5 32.26sec 15353 0 Direct 8.5 9107 18219 10751 18.0%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.47 8.47 0.00 0.00 0.0000 0.0000 91097.52 91097.52 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.94 81.95% 9107.20 8901 9791 9107.32 8901 9791 63237 63237 0.00
crit 1.53 18.05% 18218.89 17802 19582 14363.57 0 19582 27860 27860 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 130 0.4% 8.5 32.26sec 4602 0 Direct 8.5 3903 7810 4602 17.9%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.47 8.47 0.00 0.00 0.0000 0.0000 38988.74 38988.74 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.96 82.12% 3902.89 3815 4196 3902.68 0 4196 27155 27155 0.00
crit 1.52 17.88% 7809.93 7629 8392 6125.88 0 8392 11834 11834 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5276 14.4% 80.8 3.62sec 19568 15557 Direct 80.8 16589 33165 19568 18.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.79 80.79 0.00 0.00 1.2578 0.0000 1580803.23 1580803.23 0.00 15556.94 15556.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.27 82.03% 16588.68 8882 21253 16594.45 15940 17470 1099251 1099251 0.00
crit 14.52 17.97% 33164.91 17765 42507 33176.20 29908 37464 481553 481553 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2551 7.0% 14.2 21.34sec 53949 55082 Direct 14.2 2855 5703 3362 17.8%  
Periodic 230.9 2632 5262 3103 17.9% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.16 14.16 230.86 230.86 0.9795 1.2902 763930.56 763930.56 0.00 2450.69 55081.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.64 82.20% 2854.71 2589 3565 2855.97 2621 3202 33229 33229 0.00
crit 2.52 17.80% 5703.13 5177 7129 5343.19 0 7129 14374 14374 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 189.6 82.11% 2632.49 6 3319 2633.70 2565 2755 499003 499003 0.00
crit 41.3 17.89% 5261.69 6 6638 5263.51 4907 5748 217325 217325 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 827 2.3% 46.0 6.34sec 5386 0 Direct 46.0 4567 9126 5386 18.0%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.01 46.01 0.00 0.00 0.0000 0.0000 247808.82 247808.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.75 82.04% 4567.20 4180 5756 4569.27 4275 4922 172392 172392 0.00
crit 8.26 17.96% 9126.30 8360 11513 9126.41 0 11513 75417 75417 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3009 (4722) 8.2% (12.9%) 99.5 2.97sec 14212 16143 Direct 100.0 7643 15278 9015 18.0%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.54 100.03 0.00 0.00 0.8804 0.0000 901716.98 901716.98 0.00 16142.80 16142.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.06 82.04% 7643.30 6967 9594 7647.93 7378 8055 627198 627198 0.00
crit 17.97 17.96% 15277.81 13933 19188 15286.34 13933 17551 274519 274519 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1712 4.7% 77.6 3.78sec 6609 0 Direct 77.6 6609 0 6609 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.62 77.62 0.00 0.00 0.0000 0.0000 512940.80 512940.80 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.62 100.00% 6608.61 5086 14007 6611.69 5735 7592 512941 512941 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11188.33
  • base_dd_max:11188.33
  • base_dd_mult:1.00
 
Starsurge 12335 33.6% 63.8 4.74sec 57891 56996 Direct 63.6 49287 98451 58086 17.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.81 63.60 0.00 0.00 1.0157 0.0000 3693897.22 3693897.22 0.00 56995.79 56995.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.22 82.11% 49287.15 45067 61614 49308.48 47597 51656 2573570 2573570 0.00
crit 11.38 17.89% 98451.42 90135 123227 98480.83 90135 118624 1120328 1120328 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1657 4.5% 12.8 23.56sec 38779 39144 Direct 12.8 2428 4856 2859 17.7%  
Periodic 228.5 1706 3410 2012 17.9% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.80 12.80 228.51 228.51 0.9907 1.2921 496343.47 496343.47 0.00 1611.83 39143.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.53 82.26% 2428.13 2231 3073 2429.69 2251 2708 25566 25566 0.00
crit 2.27 17.74% 4856.35 4463 6146 4456.13 0 6146 11024 11024 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 187.5 82.06% 1706.33 3 2151 1707.13 1657 1780 319967 319967 0.00
crit 41.0 17.94% 3409.91 147 4302 3411.35 3169 3707 139786 139786 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6053 16.4% 93.6 3.00sec 19271 0 Direct 93.6 16350 32712 19271 17.9%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.59 93.59 0.00 0.00 0.0000 0.0000 1803476.43 1803476.43 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.88 82.15% 16349.88 15985 17583 16349.55 15985 17197 1256956 1256956 0.00
crit 16.71 17.85% 32712.15 31970 35167 32710.87 31970 34847 546520 546520 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2831 7.7% 17.6 17.08sec 48304 48716 Direct 17.6 3913 7818 4611 17.9%  
Periodic 230.1 2828 5649 3334 17.9% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.56 17.56 230.09 230.09 0.9916 1.2903 848054.26 848054.26 0.00 2698.25 48716.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.42 82.12% 3913.26 3570 4917 3914.45 3644 4255 56419 56419 0.00
crit 3.14 17.88% 7818.06 7141 9834 7570.04 0 9834 24541 24541 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 188.8 82.07% 2827.94 5 3565 2829.24 2757 2944 534000 534000 0.00
crit 41.3 17.93% 5649.47 7 7129 5651.61 5227 6174 233094 233094 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
focusing iris
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:focusing iris
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.60sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.41sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8798 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:focusing iris
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:focusing iris
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.5 56.1 42.5sec 4.7sec 93.28% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.54%
  • arcanic_pulsar_2:11.28%
  • arcanic_pulsar_3:11.26%
  • arcanic_pulsar_4:10.79%
  • arcanic_pulsar_5:12.81%
  • arcanic_pulsar_6:11.19%
  • arcanic_pulsar_7:11.44%
  • arcanic_pulsar_8:12.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.4sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.7sec 182.7sec 8.11% 8.42% 0.0(0.0) 2.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.0 0.0 39.4sec 39.4sec 26.51% 32.94% 0.0(0.0) 7.8

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:26.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.1 61.3sec 46.0sec 23.52% 0.00% 1.1(1.1) 4.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Focused Energy 1.0 383.1 0.0sec 0.8sec 100.00% 99.73% 376.1(376.1) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_focused_energy
  • max_stacks:10
  • duration:4.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:33.31

Stack Uptimes

  • focused_energy_3:0.42%
  • focused_energy_4:0.31%
  • focused_energy_5:0.41%
  • focused_energy_6:0.21%
  • focused_energy_7:0.20%
  • focused_energy_8:0.20%
  • focused_energy_9:0.20%
  • focused_energy_10:98.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295248
  • name:Focused Energy
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc295246=Your damaging spells and abilities grant you {$s2=0} Haste for {$295248d=4 seconds}, stacking up to {$295248u=10} times. This Haste is lost if you stop using spells or abilities against the initial target.$?a295252[ When you have no stacks of Focused Energy, generate {$s1=1} stacks from your first damaging spell or ability.][]}
  • max_stacks:10
  • duration:4.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.24% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.95%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.85%
  • ignition_mages_fuse_4:3.80%
  • ignition_mages_fuse_5:3.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 36.4 47.5 8.4sec 3.6sec 81.77% 99.76% 2.0(2.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.94%
  • lunar_empowerment_2:31.10%
  • lunar_empowerment_3:14.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.6 3.7 63.9sec 33.0sec 49.21% 0.00% 3.7(51.6) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.40%
  • overwhelming_power_2:1.44%
  • overwhelming_power_3:1.48%
  • overwhelming_power_4:1.53%
  • overwhelming_power_5:1.57%
  • overwhelming_power_6:1.61%
  • overwhelming_power_7:1.66%
  • overwhelming_power_8:1.71%
  • overwhelming_power_9:1.76%
  • overwhelming_power_10:1.81%
  • overwhelming_power_11:1.86%
  • overwhelming_power_12:1.91%
  • overwhelming_power_13:1.97%
  • overwhelming_power_14:2.03%
  • overwhelming_power_15:2.09%
  • overwhelming_power_16:2.15%
  • overwhelming_power_17:2.22%
  • overwhelming_power_18:2.29%
  • overwhelming_power_19:2.36%
  • overwhelming_power_20:2.44%
  • overwhelming_power_21:2.52%
  • overwhelming_power_22:2.59%
  • overwhelming_power_23:2.68%
  • overwhelming_power_24:2.76%
  • overwhelming_power_25:1.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 26.9 53.0 11.1sec 3.8sec 84.68% 77.74% 0.2(0.2) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:29.20%
  • solar_empowerment_2:39.12%
  • solar_empowerment_3:16.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 48.5 20.2sec 4.7sec 97.94% 93.17% 18.2(18.2) 11.4

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:13.43%
  • starlord_2:21.95%
  • starlord_3:62.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.9sec 45.6sec 23.66% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.66%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
focusing iris
starsurge Astral Power 63.8 2552.3 40.0 40.0 1447.3
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 100.54 804.25 (31.98%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.18%) 40.00 0.00 0.00%
sunfire Astral Power 17.56 52.67 (2.09%) 3.00 0.00 0.00%
shooting_stars Astral Power 46.01 184.05 (7.32%) 4.00 0.00 0.00%
moonfire Astral Power 14.16 42.48 (1.69%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.80 102.39 (4.07%) 8.00 0.00 0.00%
lunar_strike Astral Power 80.79 969.36 (38.55%) 12.00 0.07 0.01%
natures_balance Astral Power 400.43 200.21 (7.96%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.61 79.28 (3.15%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.38 8.51
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.82 0.00 60.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data focusing iris Fight Length
Count 7600
Mean 299.94
Minimum 240.00
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data focusing iris Damage Per Second
Count 7600
Mean 36685.49
Minimum 33126.67
Maximum 41225.03
Spread ( max - min ) 8098.36
Range [ ( max - min ) / 2 * 100% ] 11.04%
Standard Deviation 1126.2702
5th Percentile 34934.15
95th Percentile 38601.03
( 95th Percentile - 5th Percentile ) 3666.88
Mean Distribution
Standard Deviation 12.9192
95.00% Confidence Intervall ( 36660.17 - 36710.81 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3621
0.1 Scale Factor Error with Delta=300 10829
0.05 Scale Factor Error with Delta=300 43315
0.01 Scale Factor Error with Delta=300 1082852
Priority Target DPS
Sample Data focusing iris Priority Target Damage Per Second
Count 7600
Mean 36685.49
Minimum 33126.67
Maximum 41225.03
Spread ( max - min ) 8098.36
Range [ ( max - min ) / 2 * 100% ] 11.04%
Standard Deviation 1126.2702
5th Percentile 34934.15
95th Percentile 38601.03
( 95th Percentile - 5th Percentile ) 3666.88
Mean Distribution
Standard Deviation 12.9192
95.00% Confidence Intervall ( 36660.17 - 36710.81 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3621
0.1 Scale Factor Error with Delta=300 10829
0.05 Scale Factor Error with Delta=300 43315
0.01 Scale Factor Error with Delta=300 1082852
DPS(e)
Sample Data focusing iris Damage Per Second (Effective)
Count 7600
Mean 36685.49
Minimum 33126.67
Maximum 41225.03
Spread ( max - min ) 8098.36
Range [ ( max - min ) / 2 * 100% ] 11.04%
Damage
Sample Data focusing iris Damage
Count 7600
Mean 10979058.02
Minimum 8531572.10
Maximum 13654840.80
Spread ( max - min ) 5123268.70
Range [ ( max - min ) / 2 * 100% ] 23.33%
DTPS
Sample Data focusing iris Damage Taken Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data focusing iris Healing Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data focusing iris Healing Per Second (Effective)
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data focusing iris Heal
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data focusing iris Healing Taken Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data focusing iris Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data focusing irisTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data focusing iris Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 thorns
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
I 3.00 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
J 63.81 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
K 2.57 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
L 3.00 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
M 14.74 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
N 11.16 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 12.80 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 81.14 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 99.80 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.25 sunfire

Sample Sequence

0123456789ACDJNMOHFGJQPJQPQPJQPJQMQPNQPQJOJQPJPPPQQPQQJQJMJQPQLPPJPQJOPQJPQMQQJPPQQNJPQJPPMOQJQPQJQLPPJQPQJMQPQJOQPPQQPNJJPMPJQPQJPQPOQQQNJMGJQPQPJPPJQPPQJQPMOQJNPJQPQPJQPJQPMPQPJQJOQPLPJQPJQMPQPPJHEFQJQNOQJQPJQMQPJQPQPQJQPJQPJNPMOJPPPQQQJJPPQQJMNPQJOPQQQQGJPJQPJQPQKNJPQPJQPQPJ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask focusing iris 58.0/100: 58% astral_power
Pre precombat 1 food focusing iris 58.0/100: 58% astral_power
Pre precombat 2 augmentation focusing iris 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power focused_energy(3), battle_potion_of_intellect
0:01.234 default N moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, focused_energy(3), battle_potion_of_intellect
0:02.157 default M sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, focused_energy(4), battle_potion_of_intellect
0:03.077 default O stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, focused_energy(5), battle_potion_of_intellect
0:03.993 default H celestial_alignment Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(7), battle_potion_of_intellect
0:04.783 default F berserking Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(8), battle_potion_of_intellect
0:04.783 default G use_items Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(8), battle_potion_of_intellect
0:04.783 default J starsurge Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(8), battle_potion_of_intellect, ignition_mages_fuse
0:05.539 default Q solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(9), battle_potion_of_intellect, ignition_mages_fuse
0:06.292 default P lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:07.135 default J starsurge Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:07.888 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:08.642 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:09.462 default Q solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.218 default P lunar_strike Fluffy_Pillow 58.5/100: 59% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.010 default J starsurge Fluffy_Pillow 71.0/100: 71% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.766 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.521 default P lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(25), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.276 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.031 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(23), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.786 default M sunfire Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(23), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.541 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.294 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(21), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.048 default N moonfire Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.801 default Q solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.555 default P lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.319 default Q solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(18), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.073 default J starsurge Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, torrent_of_elements, overwhelming_power(17), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.829 default O stellar_flare Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(25), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.584 default J starsurge Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(24), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.340 default Q solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(23), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.094 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(22), focused_energy(10), ignition_mages_fuse(5)
0:23.848 default J starsurge Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(22), focused_energy(10), ignition_mages_fuse(5)
0:24.601 default P lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), focused_energy(10), ignition_mages_fuse(5)
0:25.444 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), focused_energy(10)
0:26.451 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), focused_energy(10)
0:27.461 default Q solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18), focused_energy(10)
0:28.213 default Q solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(17), focused_energy(10)
0:28.966 default P lunar_strike Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(17), focused_energy(10)
0:29.984 default Q solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(16), focused_energy(10)
0:30.786 default Q solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(15), focused_energy(10)
0:31.591 default J starsurge Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(14), focused_energy(10)
0:32.399 default Q solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(13), focused_energy(10)
0:33.154 default J starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(12), focused_energy(10)
0:33.909 default M sunfire Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(12), focused_energy(10)
0:34.663 default J starsurge Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(11), focused_energy(10)
0:35.416 default Q solar_wrath Fluffy_Pillow 0.5/100: 1% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10), focused_energy(10)
0:36.169 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(9), focused_energy(10)
0:37.078 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25), focused_energy(10)
0:37.831 default L moonfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(25), focused_energy(10)
0:38.587 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24), focused_energy(10)
0:39.580 default P lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), focused_energy(10)
0:40.575 default J starsurge Fluffy_Pillow 59.0/100: 59% astral_power bloodlust, arcanic_pulsar(2), solar_empowerment, torrent_of_elements, overwhelming_power(22), focused_energy(10)
0:41.432 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(21), focused_energy(10)
0:42.809 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(20), focused_energy(10)
0:43.732 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(19), focused_energy(10)
0:44.822 default O stellar_flare Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(18), focused_energy(10)
0:45.885 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(17), focused_energy(10)
0:47.243 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(15), focused_energy(10)
0:48.155 default J starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), overwhelming_power(14), focused_energy(10)
0:49.233 default P lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(13), focused_energy(10)
0:50.572 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), overwhelming_power(12), focused_energy(10)
0:51.469 default M sunfire Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(11), focused_energy(10)
0:52.527 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(10), focused_energy(10)
0:53.432 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(9), focused_energy(10)
0:54.340 default J starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3), overwhelming_power(8), focused_energy(10)
0:55.410 default P lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(7), focused_energy(10)
0:56.776 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(6), focused_energy(10)
0:58.149 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(4), focused_energy(10)
0:59.072 default Q solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(3), focused_energy(10)
0:59.997 default N moonfire Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(3), focused_energy(10)
1:01.085 default J starsurge Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(6), overwhelming_power, focused_energy(10)
1:02.282 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, focused_energy(10)
1:03.764 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord, focused_energy(10)
1:04.756 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, focused_energy(10)
1:05.920 default P lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10)
1:07.362 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10)
1:08.804 default M sunfire Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(2), focused_energy(10)
1:09.937 default O stellar_flare Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(2), focused_energy(10)
1:11.069 default Q solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(2), focused_energy(10)
1:12.031 default J starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), focused_energy(10)
1:13.163 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10)
1:13.977 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
1:15.198 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power celestial_alignment, solar_empowerment(3), starlord(3), focused_energy(10), conch_of_dark_whispers
1:16.012 default J starsurge Fluffy_Pillow 55.5/100: 56% astral_power celestial_alignment, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
1:16.972 default Q solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10), conch_of_dark_whispers
1:17.788 default L moonfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
1:18.746 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
1:20.148 default P lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
1:21.551 default J starsurge Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar, solar_empowerment(2), focused_energy(10), conch_of_dark_whispers
1:22.751 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord, focused_energy(10), conch_of_dark_whispers
1:23.742 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, focused_energy(10), conch_of_dark_whispers
1:25.224 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(2), solar_empowerment(3), starlord, focused_energy(10), conch_of_dark_whispers
1:26.215 default J starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord, focused_energy(10), conch_of_dark_whispers
1:27.380 default M sunfire Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(2), focused_energy(10), conch_of_dark_whispers
1:28.514 default Q solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(2), focused_energy(10), conch_of_dark_whispers
1:29.474 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10), conch_of_dark_whispers
1:30.916 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(2), focused_energy(10)
1:31.878 default J starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), focused_energy(10)
1:33.011 default O stellar_flare Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10)
1:34.112 default Q solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10)
1:35.049 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10)
1:36.449 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
1:37.852 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), focused_energy(10)
1:38.788 default Q solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), focused_energy(10)
1:39.723 default P lunar_strike Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(4), lunar_empowerment, starlord(3), focused_energy(10)
1:41.124 default N moonfire Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(4), starlord(3), focused_energy(10)
1:42.226 default J starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(4), focused_energy(10)
1:43.426 default J starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, focused_energy(10)
1:44.590 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10)
1:46.033 default M sunfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10)
1:47.167 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10)
1:48.610 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), focused_energy(10)
1:49.743 default Q solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10)
1:50.679 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
1:52.082 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), focused_energy(10)
1:53.019 default J starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), focused_energy(10)
1:54.121 default P lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
1:55.523 default Q solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), focused_energy(10)
1:56.460 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10)
1:57.863 default O stellar_flare Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), focused_energy(10)
1:58.964 default Q solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), focused_energy(10)
1:59.900 default Q solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(8), starlord(3), focused_energy(10)
2:01.003 default Q solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(8), starlord(3), focused_energy(10)
2:02.104 default N moonfire Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(25), focused_energy(10)
2:03.112 default J starsurge Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(8), overwhelming_power(24), focused_energy(10)
2:04.215 default M sunfire Fluffy_Pillow 54.5/100: 55% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(23), focused_energy(10)
2:05.150 default G use_items Fluffy_Pillow 58.0/100: 58% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(22), focused_energy(10)
2:05.150 default J starsurge Fluffy_Pillow 58.0/100: 58% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(22), focused_energy(10), ignition_mages_fuse
2:06.054 default Q solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(21), focused_energy(10), ignition_mages_fuse
2:06.809 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(21), focused_energy(10), ignition_mages_fuse
2:07.933 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(20), focused_energy(10), ignition_mages_fuse
2:08.687 default P lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(19), focused_energy(10), ignition_mages_fuse
2:09.818 default J starsurge Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(18), focused_energy(10), ignition_mages_fuse(2)
2:10.803 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(17), focused_energy(10), ignition_mages_fuse(2)
2:12.031 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(15), focused_energy(10), ignition_mages_fuse(2)
2:13.268 default J starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(25), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
2:14.177 default Q solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(24), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
2:14.949 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
2:16.109 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.275 default Q solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(3), overwhelming_power(21), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
2:18.032 default J starsurge Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(20), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
2:18.923 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(20), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
2:19.679 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
2:20.817 default M sunfire Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(18), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
2:21.715 default O stellar_flare Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(17), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
2:22.585 default Q solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(24), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
2:23.338 default J starsurge Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, overwhelming_power(23), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
2:24.272 default N moonfire Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(22), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
2:25.181 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(21), focused_energy(10), conch_of_dark_whispers
2:26.559 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(20), focused_energy(10), conch_of_dark_whispers
2:27.646 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(19), focused_energy(10), conch_of_dark_whispers
2:28.547 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(18), focused_energy(10)
2:29.901 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(17), focused_energy(10)
2:30.807 default P lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(16), focused_energy(10)
2:32.169 default J starsurge Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(14), focused_energy(10)
2:33.247 default Q solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(13), focused_energy(10)
2:34.141 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(12), focused_energy(10)
2:35.484 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(11), focused_energy(10)
2:36.542 default Q solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(10), focused_energy(10)
2:37.445 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(9), focused_energy(10)
2:38.804 default M sunfire Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(8), focused_energy(10)
2:39.875 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(7), focused_energy(10)
2:41.244 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(5), focused_energy(10)
2:42.164 default P lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(4), focused_energy(10)
2:43.545 default J starsurge Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(8), solar_empowerment, overwhelming_power(3), focused_energy(10)
2:44.731 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(2), focused_energy(10)
2:45.585 default J starsurge Fluffy_Pillow 50.0/100: 50% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power, focused_energy(10)
2:46.594 default O stellar_flare Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10)
2:47.579 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10)
2:48.416 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), focused_energy(10)
2:49.670 default L moonfire Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10)
2:50.654 default P lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10), conch_of_dark_whispers
2:52.097 default J starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10), conch_of_dark_whispers
2:53.230 default Q solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10), conch_of_dark_whispers
2:54.166 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
2:55.570 default J starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
2:56.671 default Q solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10), conch_of_dark_whispers
2:57.607 default M sunfire Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
2:58.708 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
3:00.110 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10), conch_of_dark_whispers
3:01.047 default P lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
3:02.451 default P lunar_strike Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
3:03.854 default J starsurge Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(3), solar_empowerment(2), focused_energy(10), conch_of_dark_whispers
3:05.053 default H celestial_alignment Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord, focused_energy(10)
3:06.068 default E potion Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, focused_energy(10)
3:06.068 default F berserking Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:06.068 default Q solar_wrath Fluffy_Pillow 86.0/100: 86% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:06.851 default J starsurge Fluffy_Pillow 94.5/100: 95% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:07.774 default Q solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:08.535 default N moonfire Fluffy_Pillow 63.5/100: 64% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:09.429 default O stellar_flare Fluffy_Pillow 67.0/100: 67% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:10.325 default Q solar_wrath Fluffy_Pillow 75.5/100: 76% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:11.085 default J starsurge Fluffy_Pillow 84.0/100: 84% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:11.980 default Q solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:12.733 default P lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:13.843 default J starsurge Fluffy_Pillow 70.0/100: 70% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:14.715 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:15.471 default M sunfire Fluffy_Pillow 39.0/100: 39% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:16.342 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:17.098 default P lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:18.206 default J starsurge Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:19.166 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:19.981 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:21.200 default Q solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:22.014 default P lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:23.233 default Q solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:24.190 default J starsurge Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:25.234 default Q solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:26.096 default P lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power celestial_alignment, lunar_empowerment(3), starlord, torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:27.387 default J starsurge Fluffy_Pillow 70.0/100: 70% astral_power celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:28.399 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:29.237 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:30.490 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:31.474 default N moonfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10)
3:32.575 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10)
3:33.979 default M sunfire Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10)
3:35.080 default O stellar_flare Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10)
3:36.182 default J starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10)
3:37.284 default P lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
3:38.688 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
3:40.089 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
3:41.492 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
3:42.428 default Q solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), focused_energy(10)
3:43.366 default Q solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(3), starlord(3), focused_energy(10)
3:44.466 default J starsurge Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar(3), focused_energy(10), conch_of_dark_whispers
3:45.665 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, focused_energy(10), conch_of_dark_whispers
3:46.829 default P lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10), conch_of_dark_whispers
3:48.271 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10), conch_of_dark_whispers
3:49.715 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), focused_energy(10), conch_of_dark_whispers
3:50.678 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), focused_energy(10), conch_of_dark_whispers
3:51.640 default J starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(5), starlord(2), focused_energy(10), conch_of_dark_whispers
3:52.772 default M sunfire Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers
3:53.874 default N moonfire Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers
3:54.977 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers
3:56.380 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers
3:57.313 default J starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(6), starlord(3), focused_energy(10), conch_of_dark_whispers
3:58.415 default O stellar_flare Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers
3:59.515 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10)
4:00.917 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), focused_energy(10)
4:01.853 default Q solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(7), starlord(3), focused_energy(10)
4:02.955 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(7), starlord(3), focused_energy(10)
4:04.058 default Q solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(25), focused_energy(10)
4:05.067 default G use_items Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(7), overwhelming_power(24), focused_energy(10)
4:05.067 default J starsurge Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(7), overwhelming_power(24), focused_energy(10), ignition_mages_fuse
4:06.132 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(23), focused_energy(10), ignition_mages_fuse
4:07.452 default J starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(8), solar_empowerment, starlord, overwhelming_power(22), focused_energy(10), ignition_mages_fuse
4:08.491 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(21), focused_energy(10), ignition_mages_fuse
4:09.245 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(20), focused_energy(10), ignition_mages_fuse(2)
4:10.332 default J starsurge Fluffy_Pillow 42.5/100: 43% astral_power celestial_alignment, solar_empowerment(2), starlord(2), overwhelming_power(19), focused_energy(10), ignition_mages_fuse(2)
4:11.188 default Q solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(18), focused_energy(10), ignition_mages_fuse(2)
4:11.942 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18), focused_energy(10), ignition_mages_fuse(2)
4:13.007 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(16), focused_energy(10), ignition_mages_fuse(2)
4:13.761 default K sunfire Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(16), focused_energy(10), ignition_mages_fuse(3)
4:14.572 default N moonfire Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(15), focused_energy(10), ignition_mages_fuse(3)
4:15.508 default J starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(14), focused_energy(10), ignition_mages_fuse(3)
4:16.448 default P lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(13), focused_energy(10), ignition_mages_fuse(3)
4:17.648 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(12), focused_energy(10), ignition_mages_fuse(4)
4:18.424 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(11), focused_energy(10), ignition_mages_fuse(4)
4:19.590 default J starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(25), focused_energy(10), ignition_mages_fuse(4)
4:20.469 default Q solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(24), focused_energy(10), ignition_mages_fuse(4)
4:21.223 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23), focused_energy(10), ignition_mages_fuse(5)
4:22.314 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(3), overwhelming_power(22), focused_energy(10), ignition_mages_fuse(5)
4:23.070 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), focused_energy(10), ignition_mages_fuse(5)
4:24.166 default J starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(20), focused_energy(10), ignition_mages_fuse(5)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="focusing iris"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/thorns
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

life-force : 39304 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
39304.0 39304.0 31.8 / 0.081% 5419.9 / 13.8% 4529.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.3 8.1 Astral Power 0.00% 58.6 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
life-force 39304
Azerite Spike 744 1.9% 17.0 17.09sec 13132 0 Direct 17.0 11156 22296 13145 17.9%  

Stats details: azerite_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.97 16.96 0.00 0.00 0.0000 0.0000 222889.86 222889.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.93 82.14% 11156.34 10657 12308 11153.19 10657 11861 155383 155383 0.00
crit 3.03 17.86% 22295.95 21313 24617 21283.36 0 24617 67507 67507 0.00
 
 

Action details: azerite_spike

Static Values
  • id:295835
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:90.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295835
  • name:Azerite Spike
  • school:fire
  • tooltip:
  • description:{$@spelldesc295834=Your spells and abilities have a high chance to impale your target with a spike of Azerite, causing ${$m1*(1+$@versadmg)} Fire damage.$?a295837[ When an Azerite spike deals damage, all damage you deal against that target is increased by {$295838s1=5}% for {$295838d=6 seconds}.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9704.69
  • base_dd_max:9704.69
  • base_dd_mult:1.00
 
Heed My Call 306 (438) 0.8% (1.1%) 8.3 32.51sec 15738 0 Direct 8.3 9326 18649 11002 18.0%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.33 8.33 0.00 0.00 0.0000 0.0000 91675.75 91675.75 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.83 82.02% 9325.70 8901 10280 9324.41 0 10280 63734 63734 0.00
crit 1.50 17.98% 18648.69 17802 20561 14577.54 0 20561 27941 27941 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 132 0.3% 8.3 32.51sec 4736 0 Direct 8.3 3997 7991 4736 18.5%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.33 8.33 0.00 0.00 0.0000 0.0000 39460.73 39460.73 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.79 81.50% 3996.93 3815 4406 3996.22 0 4406 27144 27144 0.00
crit 1.54 18.50% 7990.52 7629 8812 6341.43 0 8812 12317 12317 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5223 13.3% 78.0 3.75sec 20051 15536 Direct 78.0 16993 33980 20051 18.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.03 78.03 0.00 0.00 1.2906 0.0000 1564545.80 1564545.80 0.00 15536.08 15536.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.98 81.99% 16992.56 8882 22316 17001.84 16268 17903 1087148 1087148 0.00
crit 14.05 18.01% 33980.15 17765 44632 33994.26 30506 39559 477398 477398 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2570 6.5% 14.0 21.38sec 54835 54438 Direct 14.0 2918 5848 3439 17.8%  
Periodic 226.0 2706 5408 3191 18.0% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.03 14.03 226.05 226.05 1.0073 1.3128 769538.85 769538.85 0.00 2475.22 54438.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.54 82.23% 2918.00 2589 3743 2920.08 2650 3231 33674 33674 0.00
crit 2.49 17.77% 5847.78 5177 7486 5474.37 0 7486 14582 14582 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 185.5 82.04% 2705.61 2 3485 2707.25 2620 2838 501773 501773 0.00
crit 40.6 17.96% 5407.86 52 6970 5410.73 5072 5960 219510 219510 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 836 2.1% 45.2 6.45sec 5537 0 Direct 45.2 4694 9381 5537 18.0%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.18 45.18 0.00 0.00 0.0000 0.0000 250162.94 250162.94 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.06 82.03% 4694.48 4180 6044 4696.91 4369 5277 173982 173982 0.00
crit 8.12 17.97% 9380.94 8360 12088 9383.73 0 11813 76181 76181 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2949 (4650) 7.5% (11.8%) 94.9 3.10sec 14673 16315 Direct 95.4 7851 15691 9255 17.9%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.90 95.42 0.00 0.00 0.8993 0.0000 883146.91 883146.91 0.00 16315.48 16315.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.34 82.10% 7851.19 6967 10073 7857.49 7537 8270 615054 615054 0.00
crit 17.09 17.90% 15691.30 13933 20147 15700.70 14201 17757 268093 268093 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1701 4.3% 75.2 3.89sec 6775 0 Direct 75.2 6775 0 6775 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.18 75.18 0.00 0.00 0.0000 0.0000 509346.88 509346.88 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.18 100.00% 6775.05 5086 14707 6780.78 5887 8034 509347 509347 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5085.61
  • base_dd_max:5085.61
  • base_dd_mult:1.00
 
Starsurge 12292 31.3% 61.9 4.87sec 59442 57239 Direct 61.7 50536 100989 59629 18.0%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.91 61.71 0.00 0.00 1.0385 0.0000 3679947.57 3679947.57 0.00 57238.92 57238.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.59 81.98% 50536.43 45067 64694 50564.38 48508 53326 2556761 2556761 0.00
crit 11.12 18.02% 100989.37 90135 129389 101024.74 90135 117761 1123186 1123186 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1669 4.3% 12.8 23.57sec 39184 38476 Direct 12.8 2488 4965 2928 17.8%  
Periodic 223.6 1753 3502 2067 18.0% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.75 12.75 223.62 223.62 1.0184 1.3161 499647.32 499647.32 0.00 1626.02 38475.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.48 82.22% 2487.82 2231 3227 2489.01 2271 2742 26084 26084 0.00
crit 2.27 17.78% 4964.71 4463 6453 4539.36 0 6453 11254 11254 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 183.4 82.02% 1752.80 7 2259 1753.87 1698 1843 321474 321474 0.00
crit 40.2 17.98% 3502.43 24 4517 3504.54 3278 3958 140835 140835 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6211 15.7% 92.6 3.01sec 19983 0 Direct 92.6 16956 33905 19982 17.9%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.58 92.58 0.00 0.00 0.0000 0.0000 1849995.14 1849995.14 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.05 82.14% 16956.38 15985 18463 16957.34 16400 17984 1289492 1289492 0.00
crit 16.53 17.86% 33905.39 31970 36925 33905.36 32406 36620 560503 560503 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2862 7.3% 18.0 16.61sec 47710 47100 Direct 18.0 4025 8044 4743 17.9%  
Periodic 225.2 2906 5808 3428 18.0% 98.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.96 17.96 225.17 225.17 1.0130 1.3140 857077.08 857077.08 0.00 2729.01 47099.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.75 82.13% 4024.97 3570 5163 4026.27 3747 4363 59387 59387 0.00
crit 3.21 17.87% 8043.82 7141 10325 7772.93 0 10325 25818 25818 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 184.7 82.01% 2905.80 2 3743 2907.57 2813 3040 536604 536604 0.00
crit 40.5 17.99% 5808.33 13 7486 5811.48 5420 6458 235268 235268 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
pet - guardian_of_azeroth 8922 / 1809
Azerite Spike 7904 4.0% 58.2 3.64sec 8145 8067 Direct 58.2 6927 13853 8145 17.6%  

Stats details: azerite_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.22 58.22 0.00 0.00 1.0097 0.0000 474218.58 474218.58 0.00 8067.27 8067.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.97 82.40% 6926.52 6927 6927 6926.52 6927 6927 332292 332292 0.00
crit 10.25 17.60% 13853.04 13853 13853 13853.04 13853 13853 141926 141926 0.00
 
 

Action details: azerite_spike

Static Values
  • id:295856
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295856
  • name:Azerite Spike
  • school:fire
  • tooltip:
  • description:Strike your target with a shard of Azerite, dealing {$s1=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6308.05
  • base_dd_max:6308.05
  • base_dd_mult:1.00
 
Azerite Volley 1018 0.5% 6.0 39.28sec 10185 0 Direct 6.0 8658 17316 10184 17.6%  

Stats details: azerite_volley

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 6.00 0.00 0.00 0.0000 0.0000 61107.15 61107.15 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.94 82.37% 8658.15 8658 8658 8658.15 8658 8658 42791 42791 0.00
crit 1.06 17.63% 17316.29 17316 17316 11841.16 0 17316 18317 18317 0.00
 
 

Action details: azerite_volley

Static Values
  • id:303351
  • school:flamestrike
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:303351
  • name:Azerite Volley
  • school:flamestrike
  • tooltip:
  • description:{$@spelldesc295841=Every $303347t1 sec, the Guardian of Azeroth will launch of volley of Azerite Spikes at the target area, dealing {$s1=2287} damage to all enemies near its target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:7884.76
  • base_dd_max:7884.76
  • base_dd_mult:1.00
 
Simple Action Stats Execute Interval
life-force
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:life-force
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.52sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.40sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8532 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:life-force
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:life-force
  • harmful:false
  • if_expr:
 
Guardian of Azeroth 2.0 0.00sec

Stats details: guardian_of_azeroth

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.1815 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: guardian_of_azeroth

Static Values
  • id:295840
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:295840
  • name:Guardian of Azeroth
  • school:physical
  • tooltip:
  • description:Call upon Azeroth to summon a Guardian of Azeroth for {$300091d=30 seconds} who impales your target with spikes of Azerite every 2 sec that deal ${$295834m1*(1+$@versadmg)} Fire damage.$?a295841[ Every $303347t1 sec, the Guardian launches a volley of Azerite Spikes at its target, dealing {$295841s1=2287} Fire damage to all nearby enemies.][]$?a295843[ Each time the Guardian of Azeroth casts a spell, you gain {$295855s1=2}% Haste, stacking up to {$295855u=5} times. This effect ends when the Guardian of Azeroth despawns.][]
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.3 54.4 43.6sec 4.9sec 92.70% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.83%
  • arcanic_pulsar_2:11.04%
  • arcanic_pulsar_3:10.89%
  • arcanic_pulsar_4:10.58%
  • arcanic_pulsar_5:13.44%
  • arcanic_pulsar_6:11.05%
  • arcanic_pulsar_7:10.65%
  • arcanic_pulsar_8:13.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 188.3sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.5sec 182.5sec 8.11% 12.63% 0.0(0.0) 2.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.9sec 37.9sec 26.04% 33.67% 0.0(0.0) 8.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:26.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.9sec 45.4sec 23.73% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:life-force
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Guardian of Azeroth 2.0 56.2 180.2sec 3.6sec 19.21% 0.00% 48.2(48.2) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_guardian_of_azeroth
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • guardian_of_azeroth_1:0.91%
  • guardian_of_azeroth_2:0.90%
  • guardian_of_azeroth_3:0.88%
  • guardian_of_azeroth_4:0.79%
  • guardian_of_azeroth_5:15.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295855
  • name:Guardian of Azeroth
  • tooltip:Haste increased by {$s1=2}%.
  • description:{$@spelldesc295843=Each time the Guardian of Azeroth casts a spell, you gain {$295855s1=2}% Haste, stacking up to {$295855u=5} times. This effect ends when the Guardian of Azeroth despawns.}
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 2.9 0.0 120.3sec 120.3sec 19.18% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:life-force
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.94%
  • ignition_mages_fuse_2:3.88%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 34.8 46.4 8.7sec 3.7sec 81.94% 99.70% 2.0(2.0) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.39%
  • lunar_empowerment_2:31.19%
  • lunar_empowerment_3:14.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.6 3.6 64.4sec 33.4sec 48.39% 0.00% 3.6(49.9) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.39%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.46%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.55%
  • overwhelming_power_6:1.59%
  • overwhelming_power_7:1.64%
  • overwhelming_power_8:1.68%
  • overwhelming_power_9:1.73%
  • overwhelming_power_10:1.78%
  • overwhelming_power_11:1.83%
  • overwhelming_power_12:1.88%
  • overwhelming_power_13:1.94%
  • overwhelming_power_14:2.00%
  • overwhelming_power_15:2.06%
  • overwhelming_power_16:2.12%
  • overwhelming_power_17:2.18%
  • overwhelming_power_18:2.25%
  • overwhelming_power_19:2.32%
  • overwhelming_power_20:2.39%
  • overwhelming_power_21:2.46%
  • overwhelming_power_22:2.54%
  • overwhelming_power_23:2.62%
  • overwhelming_power_24:2.70%
  • overwhelming_power_25:1.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 25.5 52.0 11.7sec 3.9sec 84.94% 78.91% 0.3(0.3) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.61%
  • solar_empowerment_2:39.17%
  • solar_empowerment_3:17.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 46.7 20.2sec 4.9sec 97.33% 93.69% 16.6(16.6) 11.4

Buff details

  • buff initial source:life-force
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.37%
  • starlord_2:22.43%
  • starlord_3:60.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.1sec 45.4sec 23.73% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.73%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
life-force
starsurge Astral Power 61.9 2476.4 40.0 40.0 1486.0
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 95.90 767.18 (31.46%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.28%) 40.00 0.00 0.00%
sunfire Astral Power 17.96 53.89 (2.21%) 3.00 0.00 0.00%
shooting_stars Astral Power 45.18 180.73 (7.41%) 4.00 0.01 0.00%
moonfire Astral Power 14.03 42.10 (1.73%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.75 102.01 (4.18%) 8.00 0.00 0.00%
lunar_strike Astral Power 78.03 936.26 (38.39%) 12.00 0.07 0.01%
natures_balance Astral Power 400.43 200.21 (8.21%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.37 76.46 (3.14%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.13 8.26
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.35 0.00 67.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data life-force Fight Length
Count 7600
Mean 299.94
Minimum 240.00
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data life-force Damage Per Second
Count 7600
Mean 39303.97
Minimum 35173.30
Maximum 44354.14
Spread ( max - min ) 9180.84
Range [ ( max - min ) / 2 * 100% ] 11.68%
Standard Deviation 1413.6633
5th Percentile 37110.65
95th Percentile 41733.96
( 95th Percentile - 5th Percentile ) 4623.31
Mean Distribution
Standard Deviation 16.2158
95.00% Confidence Intervall ( 39272.19 - 39335.75 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 4970
0.1 Scale Factor Error with Delta=300 17060
0.05 Scale Factor Error with Delta=300 68240
0.01 Scale Factor Error with Delta=300 1705987
Priority Target DPS
Sample Data life-force Priority Target Damage Per Second
Count 7600
Mean 39303.97
Minimum 35173.30
Maximum 44354.14
Spread ( max - min ) 9180.84
Range [ ( max - min ) / 2 * 100% ] 11.68%
Standard Deviation 1413.6633
5th Percentile 37110.65
95th Percentile 41733.96
( 95th Percentile - 5th Percentile ) 4623.31
Mean Distribution
Standard Deviation 16.2158
95.00% Confidence Intervall ( 39272.19 - 39335.75 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 4970
0.1 Scale Factor Error with Delta=300 17060
0.05 Scale Factor Error with Delta=300 68240
0.01 Scale Factor Error with Delta=300 1705987
DPS(e)
Sample Data life-force Damage Per Second (Effective)
Count 7600
Mean 39303.97
Minimum 35173.30
Maximum 44354.14
Spread ( max - min ) 9180.84
Range [ ( max - min ) / 2 * 100% ] 11.68%
Damage
Sample Data life-force Damage
Count 7600
Mean 11217434.84
Minimum 8756177.31
Maximum 13829320.52
Spread ( max - min ) 5073143.21
Range [ ( max - min ) / 2 * 100% ] 22.61%
DTPS
Sample Data life-force Damage Taken Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data life-force Healing Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data life-force Healing Per Second (Effective)
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data life-force Heal
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data life-force Healing Taken Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data life-force Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data life-forceTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data life-force Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
H 2.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 thorns
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.91 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 61.91 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.99 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.86 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.46 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.17 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.75 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 78.39 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 95.16 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.52 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRKRQKRQRQKRQRNRORQRSKPKRLQQKRQQQRKRKRQKRQMQQKNQPRKRQKRQQRQRRNKKOQRQKPRQRRQRNRJKRKRQKMQQKRQPKNRQQKRQORKQRRRKNQRPRRRKQKGRQRKRQONQKQRRQRQKKPQRQKNORQKRQQQRKQRKPNQORKRQRQRHRRKIEFKNRKRPRQKORQKRQRQRQRKLKQQKRQRPOQRRKRQJKRKLQQKRQQRKROPQNQKRKGRQQKRQQKRQRRRRRKK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask life-force 58.0/100: 58% astral_power
Pre precombat 1 food life-force 58.0/100: 58% astral_power
Pre precombat 2 augmentation life-force 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H guardian_of_azeroth Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.250 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, battle_potion_of_intellect
0:02.213 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, guardian_of_azeroth, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.128 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, guardian_of_azeroth(2), arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.027 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, guardian_of_azeroth(2), arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.924 default I celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, guardian_of_azeroth(3), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.690 default F berserking Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, guardian_of_azeroth(4), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.690 default G use_items Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, guardian_of_azeroth(4), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.690 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, guardian_of_azeroth(4), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:06.446 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.199 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.953 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(25), battle_potion_of_intellect, ignition_mages_fuse
0:08.706 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse
0:09.461 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse
0:10.215 default R solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.968 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.722 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.477 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.231 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.986 default R solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.742 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.497 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.252 default N sunfire Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(16), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.006 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(15), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.760 default O moonfire Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(15), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.514 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(14), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.267 default Q lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.021 default R solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.776 default S sunfire Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.531 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.287 default P stellar_flare Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.042 default K starsurge Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(20), ignition_mages_fuse(5)
0:23.795 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(20), ignition_mages_fuse(5)
0:24.551 default L sunfire Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(19), ignition_mages_fuse(5)
0:25.305 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(18), ignition_mages_fuse(5)
0:26.126 default Q lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(17)
0:27.113 default K starsurge Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(16)
0:27.890 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(16)
0:28.645 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(15)
0:29.613 default Q lunar_strike Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(14)
0:30.584 default Q lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(13)
0:31.654 default R solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(12)
0:32.408 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(11)
0:33.254 default R solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(10)
0:34.008 default K starsurge Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(9)
0:34.762 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(9)
0:35.517 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(8)
0:36.465 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(7)
0:37.220 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(6)
0:37.974 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(6)
0:38.932 default M moonfire Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(5)
0:39.687 default Q lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(4)
0:40.792 default Q lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(3)
0:41.902 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(2), solar_empowerment, overwhelming_power(2)
0:43.141 default N sunfire Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord
0:44.356 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord
0:45.900 default P stellar_flare Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord
0:47.113 default R solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord
0:48.144 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord
0:49.356 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2)
0:50.356 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2)
0:51.857 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2)
0:53.033 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
0:54.005 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
0:55.465 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
0:56.924 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements
0:57.898 default Q lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
0:59.358 default R solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements
1:00.333 default R solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements
1:01.479 default N sunfire Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements
1:02.625 default K starsurge Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(5), torrent_of_elements
1:03.872 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
1:05.083 default O moonfire Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
1:06.260 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
1:07.761 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2)
1:08.764 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2)
1:10.265 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2)
1:11.443 default P stellar_flare Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3)
1:12.588 default R solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3)
1:13.562 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
1:15.021 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:15.995 default R solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), conch_of_dark_whispers
1:16.969 default Q lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(25), conch_of_dark_whispers
1:18.301 default R solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(23), conch_of_dark_whispers
1:19.196 default N sunfire Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(22), conch_of_dark_whispers
1:20.254 default R solar_wrath Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(21), conch_of_dark_whispers
1:21.316 default J cancel_buff Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(20), conch_of_dark_whispers
1:21.316 default K starsurge Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(8), overwhelming_power(20), conch_of_dark_whispers
1:22.476 default R solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(19), conch_of_dark_whispers
1:23.316 default K starsurge Fluffy_Pillow 70.5/100: 71% astral_power celestial_alignment, lunar_empowerment, starlord, torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers
1:24.303 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers
1:25.124 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(16), conch_of_dark_whispers
1:26.354 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(15), conch_of_dark_whispers
1:27.324 default M moonfire Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers
1:28.270 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(13), conch_of_dark_whispers
1:29.660 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12)
1:31.056 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10)
1:32.162 default R solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(9)
1:33.103 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(8)
1:34.517 default P stellar_flare Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(7)
1:35.634 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(6)
1:36.755 default N sunfire Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(5)
1:37.880 default R solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(4)
1:38.840 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(3)
1:40.284 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power
1:41.737 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(4), solar_empowerment(2)
1:42.985 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord
1:44.016 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord
1:45.559 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord
1:46.770 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord
1:47.800 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(5), solar_empowerment, starlord
1:49.012 default Q lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2)
1:50.513 default R solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2)
1:51.513 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), conch_of_dark_whispers
1:52.514 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(6), starlord(2), conch_of_dark_whispers
1:53.691 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(6), starlord(2), conch_of_dark_whispers
1:54.868 default N sunfire Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
1:56.013 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24), conch_of_dark_whispers
1:57.349 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(23), conch_of_dark_whispers
1:58.246 default P stellar_flare Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(22), conch_of_dark_whispers
1:59.303 default R solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(21), conch_of_dark_whispers
2:00.205 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(20), conch_of_dark_whispers
2:01.273 default R solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(19), conch_of_dark_whispers
2:02.342 default K starsurge Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(7), overwhelming_power(18), conch_of_dark_whispers
2:03.514 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(17), conch_of_dark_whispers
2:04.964 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(8), solar_empowerment, starlord, overwhelming_power(16), conch_of_dark_whispers
2:06.108 default G use_items Fluffy_Pillow 15.0/100: 15% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(14), conch_of_dark_whispers
2:06.108 default R solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(14), conch_of_dark_whispers, ignition_mages_fuse
2:06.905 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(14), conch_of_dark_whispers, ignition_mages_fuse
2:08.095 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(12), conch_of_dark_whispers, ignition_mages_fuse
2:08.896 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(12), conch_of_dark_whispers, ignition_mages_fuse
2:09.838 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(11), conch_of_dark_whispers, ignition_mages_fuse
2:10.619 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(10), conch_of_dark_whispers, ignition_mages_fuse(2)
2:11.750 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(9), conch_of_dark_whispers, ignition_mages_fuse(2)
2:12.774 default N sunfire Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(8), conch_of_dark_whispers, ignition_mages_fuse(2)
2:13.801 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(7), conch_of_dark_whispers, ignition_mages_fuse(2)
2:15.113 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, starlord(3), overwhelming_power(5), conch_of_dark_whispers, ignition_mages_fuse(3)
2:16.112 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(4), conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.391 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(3), conch_of_dark_whispers, ignition_mages_fuse(3)
2:18.246 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(2), conch_of_dark_whispers, ignition_mages_fuse(4)
2:19.220 default Q lunar_strike Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power, conch_of_dark_whispers, ignition_mages_fuse(4)
2:20.463 default R solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
2:21.442 default Q lunar_strike Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
2:22.691 default K starsurge Fluffy_Pillow 88.0/100: 88% astral_power arcanic_pulsar(2), conch_of_dark_whispers, ignition_mages_fuse(5)
2:23.721 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers, ignition_mages_fuse(5)
2:24.719 default P stellar_flare Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), ignition_mages_fuse(5)
2:25.693 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), ignition_mages_fuse(5)
2:26.932 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2)
2:27.933 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2)
2:29.434 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2)
2:30.611 default N sunfire Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3)
2:31.757 default O moonfire Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3)
2:32.903 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3)
2:33.878 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:35.336 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:36.481 default R solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
2:37.456 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:38.914 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:40.374 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:41.834 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:42.809 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(6), solar_empowerment, torrent_of_elements, conch_of_dark_whispers
2:44.056 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers
2:45.603 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers
2:46.633 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(7), solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers
2:47.845 default P stellar_flare Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
2:49.022 default N sunfire Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
2:50.201 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
2:51.702 default O moonfire Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), torrent_of_elements
2:52.880 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2)
2:53.882 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2)
2:55.060 default R solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3)
2:55.906 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3)
2:57.175 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power celestial_alignment, solar_empowerment, starlord(3)
2:58.022 default Q lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power celestial_alignment, starlord(3)
2:59.514 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power celestial_alignment, solar_empowerment, starlord(3)
3:00.361 default H guardian_of_azeroth Fluffy_Pillow 69.0/100: 69% astral_power celestial_alignment, starlord(3)
3:01.359 default R solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power starlord(3)
3:02.505 default R solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power guardian_of_azeroth, starlord(3)
3:03.627 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power guardian_of_azeroth(2)
3:04.828 default I celestial_alignment Fluffy_Pillow 52.0/100: 52% astral_power guardian_of_azeroth(3), arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord
3:05.920 default E potion Fluffy_Pillow 92.5/100: 93% astral_power guardian_of_azeroth(3), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
3:05.920 default F berserking Fluffy_Pillow 92.5/100: 93% astral_power guardian_of_azeroth(3), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers, battle_potion_of_intellect
3:05.920 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power berserking, guardian_of_azeroth(3), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers, battle_potion_of_intellect
3:06.824 default N sunfire Fluffy_Pillow 53.5/100: 54% astral_power berserking, guardian_of_azeroth(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:07.687 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:08.441 default K starsurge Fluffy_Pillow 65.5/100: 66% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:09.289 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:10.043 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:10.868 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:11.620 default Q lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:12.669 default K starsurge Fluffy_Pillow 68.0/100: 68% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:13.494 default O moonfire Fluffy_Pillow 28.5/100: 28% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:14.320 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:15.074 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:16.123 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:16.947 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:17.701 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:18.749 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:19.655 default Q lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:20.810 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
3:21.716 default Q lunar_strike Fluffy_Pillow 69.0/100: 69% astral_power guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
3:22.869 default R solar_wrath Fluffy_Pillow 82.0/100: 82% astral_power guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
3:23.640 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, torrent_of_elements, battle_potion_of_intellect
3:24.628 default L sunfire Fluffy_Pillow 55.0/100: 55% astral_power guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect
3:25.587 default K starsurge Fluffy_Pillow 59.0/100: 59% astral_power guardian_of_azeroth(5), arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect
3:26.689 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power guardian_of_azeroth(5), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, battle_potion_of_intellect
3:28.055 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power guardian_of_azeroth(5), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, battle_potion_of_intellect
3:29.418 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power guardian_of_azeroth(5), arcanic_pulsar(7), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:30.491 default R solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:31.465 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
3:32.925 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
3:33.897 default P stellar_flare Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
3:35.043 default O moonfire Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
3:36.189 default Q lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
3:37.648 default R solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), conch_of_dark_whispers
3:38.621 default R solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), conch_of_dark_whispers
3:39.594 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
3:40.740 default R solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
3:41.586 default Q lunar_strike Fluffy_Pillow 76.5/100: 77% astral_power celestial_alignment, lunar_empowerment, starlord(3), conch_of_dark_whispers
3:42.855 default J cancel_buff Fluffy_Pillow 89.5/100: 90% astral_power celestial_alignment, starlord(3), conch_of_dark_whispers
3:42.855 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power celestial_alignment, conch_of_dark_whispers
3:43.943 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
3:44.840 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(25), conch_of_dark_whispers
3:45.804 default L sunfire Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(24), conch_of_dark_whispers
3:46.744 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(23), conch_of_dark_whispers
3:48.125 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(21), conch_of_dark_whispers
3:49.516 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(20), conch_of_dark_whispers
3:50.610 default R solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(19), conch_of_dark_whispers
3:51.519 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18), conch_of_dark_whispers
3:52.885 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17), conch_of_dark_whispers
3:54.257 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(3), overwhelming_power(15), conch_of_dark_whispers
3:55.180 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(14), conch_of_dark_whispers
3:56.267 default R solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(13), conch_of_dark_whispers
3:57.195 default O moonfire Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(12), conch_of_dark_whispers
3:58.293 default P stellar_flare Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(11), conch_of_dark_whispers
3:59.394 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(10), conch_of_dark_whispers
4:00.799 default N sunfire Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(9), conch_of_dark_whispers
4:01.909 default Q lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(8), conch_of_dark_whispers
4:03.325 default K starsurge Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(4), solar_empowerment(2), overwhelming_power(6), conch_of_dark_whispers
4:04.546 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(5), conch_of_dark_whispers
4:05.557 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(4)
4:06.752 default G use_items Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(3)
4:06.752 default R solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(3), ignition_mages_fuse
4:07.703 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(2), ignition_mages_fuse
4:09.134 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), ignition_mages_fuse
4:10.573 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), ignition_mages_fuse
4:11.703 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), ignition_mages_fuse(2)
4:12.601 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
4:13.948 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
4:15.294 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
4:16.310 default R solar_wrath Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), ignition_mages_fuse(3)
4:17.176 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
4:18.471 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
4:19.335 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), ignition_mages_fuse(4)
4:20.166 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(8), starlord(3), ignition_mages_fuse(4)
4:21.143 default R solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(8), starlord(3), ignition_mages_fuse(4)
4:22.122 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(8), starlord(3), ignition_mages_fuse(4)
4:23.100 default K starsurge Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, ignition_mages_fuse(5)
4:24.046 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, torrent_of_elements, overwhelming_power(24), ignition_mages_fuse(5)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="life-force"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/thorns
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

lucid dreams : 38027 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
38026.9 38026.9 27.8 / 0.073% 4780.8 / 12.6% 3939.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
9.6 9.5 Astral Power 0.00% 59.1 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
lucid dreams 38027
Heed My Call 298 (425) 0.8% (1.1%) 8.2 33.10sec 15515 0 Direct 8.2 9201 18402 10864 18.1%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.21 8.21 0.00 0.00 0.0000 0.0000 89158.01 89158.01 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.72 81.92% 9200.51 8901 10180 9197.94 0 10180 61855 61855 0.00
crit 1.48 18.08% 18402.28 17802 20359 14350.89 0 20359 27303 27303 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 127 0.3% 8.2 33.10sec 4651 0 Direct 8.2 3943 7885 4651 18.0%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.21 8.21 0.00 0.00 0.0000 0.0000 38169.91 38169.91 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.73 82.04% 3943.26 3815 4363 3942.87 0 4363 26550 26550 0.00
crit 1.47 17.96% 7885.04 7629 8725 6061.65 0 8725 11620 11620 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5021 13.2% 76.2 3.83sec 19748 15015 Direct 76.2 16750 33481 19748 17.9%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.23 76.23 0.00 0.00 1.3152 0.0000 1505368.28 1505368.28 0.00 15014.94 15014.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.57 82.08% 16749.98 8882 22097 16757.31 16179 17611 1048056 1048056 0.00
crit 13.66 17.92% 33481.08 20430 44195 33491.65 30866 39075 457313 457313 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2495 6.6% 14.2 21.27sec 52741 51728 Direct 14.2 2860 5723 3373 17.9%  
Periodic 222.4 2667 5329 3145 17.9% 99.2%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.17 14.17 222.43 222.43 1.0196 1.3378 747309.53 747309.53 0.00 2395.15 51727.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.63 82.08% 2860.18 2589 3706 2861.33 2640 3107 33266 33266 0.00
crit 2.54 17.92% 5723.07 5177 7413 5362.18 0 7413 14530 14530 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 182.5 82.06% 2667.33 2 3451 2668.57 2582 2778 486864 486864 0.00
crit 39.9 17.94% 5328.84 16 6901 5331.20 4938 5886 212650 212650 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 810 2.1% 44.4 6.56sec 5462 0 Direct 44.4 4628 9258 5462 18.0%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.42 44.42 0.00 0.00 0.0000 0.0000 242648.39 242648.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.42 81.99% 4628.22 4180 5985 4630.23 4339 5051 168574 168574 0.00
crit 8.00 18.01% 9257.91 8360 11970 9253.19 0 11513 74074 74074 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2593 (4387) 6.8% (11.5%) 84.2 3.48sec 15611 17582 Direct 84.9 7758 15519 9152 18.0%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.19 84.86 0.00 0.00 0.8879 0.0000 776627.44 776627.44 0.00 17582.42 17582.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.61 82.03% 7757.71 6967 9975 7762.05 7473 8184 540036 540036 0.00
crit 15.25 17.97% 15518.98 13933 19950 15527.58 14056 17613 236592 236592 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1795 4.7% 80.2 3.64sec 6701 0 Direct 80.2 6701 0 6701 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.24 80.24 0.00 0.00 0.0000 0.0000 537675.87 537675.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.24 100.00% 6701.13 5086 14563 6704.55 5931 7664 537676 537676 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5594.17
  • base_dd_max:5594.17
  • base_dd_mult:1.00
 
Starsurge 14153 37.2% 72.2 4.20sec 58669 56574 Direct 71.9 49993 99864 58914 17.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.22 71.92 0.00 0.00 1.0370 0.0000 4237020.07 4237020.07 0.00 56574.31 56574.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.05 82.11% 49992.92 45067 64060 50013.74 48108 52737 2952304 2952304 0.00
crit 12.86 17.89% 99864.07 90135 128121 99892.38 90135 118624 1284716 1284716 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1623 4.3% 12.8 23.58sec 38038 36907 Direct 12.8 2447 4889 2879 17.7%  
Periodic 220.2 1729 3456 2040 18.0% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.78 12.78 220.21 220.21 1.0307 1.3398 486070.63 486070.63 0.00 1577.09 36907.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.52 82.31% 2447.02 2231 3195 2447.94 2231 2736 25738 25738 0.00
crit 2.26 17.69% 4888.77 4463 6390 4475.62 0 6390 11052 11052 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.5 81.98% 1729.06 5 2237 1729.89 1681 1807 312129 312129 0.00
crit 39.7 18.02% 3455.84 34 4473 3457.22 3238 3796 137152 137152 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6343 16.6% 96.8 2.91sec 19525 0 Direct 96.8 16560 33119 19525 17.9%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.83 96.83 0.00 0.00 0.0000 0.0000 1890566.89 1890566.89 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.49 82.10% 16559.97 15985 18282 16559.40 15985 17562 1316420 1316420 0.00
crit 17.34 17.90% 33119.27 31970 36563 33120.46 31970 35578 574147 574147 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2770 7.3% 17.4 17.16sec 47552 46603 Direct 17.4 3970 7947 4688 18.0%  
Periodic 221.6 2863 5723 3375 17.9% 98.9%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.45 17.45 221.56 221.56 1.0204 1.3389 829629.62 829629.62 0.00 2638.39 46603.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.30 81.95% 3970.41 3570 5112 3971.61 3691 4313 56770 56770 0.00
crit 3.15 18.05% 7946.84 7141 10224 7682.99 0 10224 25020 25020 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.9 82.08% 2862.97 2 3706 2864.30 2752 2999 520684 520684 0.00
crit 39.7 17.92% 5722.75 20 7413 5725.20 5335 6228 227156 227156 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
lucid dreams
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lucid dreams
  • harmful:false
  • if_expr:
 
Berserking 2.0 181.98sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 185.01sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8640 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&!buff.ca_inc.up&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lucid dreams
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lucid dreams
  • harmful:false
  • if_expr:
 
Memory of Lucid Dreams 2.9 123.00sec

Stats details: memory_of_lucid_dreams

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 1.0151 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: memory_of_lucid_dreams

Static Values
  • id:298357
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:dot.sunfire.remains>10&dot.moonfire.remains>10&(astral_power<40|cooldown.ca_inc.remains>30)&dot.stellar_flare.remains>10&!buff.ca_inc.up
Spelldata
  • id:298357
  • name:Memory of Lucid Dreams
  • school:physical
  • tooltip:$?a300120[Shield of the Righteous recharge rate increased by ${{$300120s1=50}*-2}%]?a303412[Frostbolt and Flurry will generate an additional Icicle]?a303399[Fire Blast recharge rate increased by ${{$303399s1=50}*-2}%][{$@spelldesc304633=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Rune]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]} generation increased by {$s1=100}%].$?$w2>0[ Leech increased by $w2.][]
  • description:Clear your mind and attune yourself with the Heart of Azeroth, $?a137028[increasing your Shield of the Righteous recharge rate by ${{$300120s1=50}*-2}%]?a137020[causing Frostbolt and Flurry to generate an additional Icicle]?a137019[increasing your Fire Blast recharge rate by ${{$303399s1=50}*-2}%][increasing your {$@spelldesc304633=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Rune]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]} generation rate by {$s1=100}%]$?a298377[ and ][]$?a137020&a298377[increases ][]$?a298377[your Leech by {$298268s6=224}][] for {$d=12 seconds}.
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 8.4 63.5 37.7sec 4.2sec 92.33% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:10.86%
  • arcanic_pulsar_2:12.22%
  • arcanic_pulsar_3:11.90%
  • arcanic_pulsar_4:11.21%
  • arcanic_pulsar_5:11.05%
  • arcanic_pulsar_6:11.54%
  • arcanic_pulsar_7:11.68%
  • arcanic_pulsar_8:11.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 191.7sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 181.9sec 181.9sec 8.11% 8.22% 0.0(0.0) 2.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.3 0.0 37.5sec 37.5sec 28.32% 35.68% 0.0(0.0) 8.1

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:28.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.1sec 45.7sec 23.56% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.10% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.92%
  • ignition_mages_fuse_2:3.87%
  • ignition_mages_fuse_3:3.82%
  • ignition_mages_fuse_4:3.77%
  • ignition_mages_fuse_5:3.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lucid Dreams 8.3 2.5 34.4sec 25.9sec 25.32% 0.00% 2.5(2.5) 8.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_lucid_dreams
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:353.31

Stack Uptimes

  • lucid_dreams_1:25.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:298343
  • name:Lucid Dreams
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc298339=When Lucid Dreams $?!a137020[refunds ][]$?a137028[part of a Shield of the Righteous charge]?a137019[part of a charge of Fire Blast]?a137020[generates an icicle][{$@spelldesc298373=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Runes]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]}], gain {$s1=0} Versatility for {$298343d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Lunar Empowerment 16.2 73.0 18.2sec 3.4sec 93.76% 99.99% 10.8(10.8) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:19.88%
  • lunar_empowerment_2:42.93%
  • lunar_empowerment_3:30.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Memory of Lucid Dreams 2.9 0.0 123.0sec 123.0sec 14.23% 16.57% 0.0(0.0) 2.8

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_memory_of_lucid_dreams
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:leech_rating
  • amount:0.00

Stack Uptimes

  • memory_of_lucid_dreams_1:14.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:298357
  • name:Memory of Lucid Dreams
  • tooltip:$?a300120[Shield of the Righteous recharge rate increased by ${{$300120s1=50}*-2}%]?a303412[Frostbolt and Flurry will generate an additional Icicle]?a303399[Fire Blast recharge rate increased by ${{$303399s1=50}*-2}%][{$@spelldesc304633=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Rune]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]} generation increased by {$s1=100}%].$?$w2>0[ Leech increased by $w2.][]
  • description:Clear your mind and attune yourself with the Heart of Azeroth, $?a137028[increasing your Shield of the Righteous recharge rate by ${{$300120s1=50}*-2}%]?a137020[causing Frostbolt and Flurry to generate an additional Icicle]?a137019[increasing your Fire Blast recharge rate by ${{$303399s1=50}*-2}%][increasing your {$@spelldesc304633=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Rune]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]} generation rate by {$s1=100}%]$?a298377[ and ][]$?a137020&a298377[increases ][]$?a298377[your Leech by {$298268s6=224}][] for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.5 3.4 64.7sec 34.1sec 47.62% 0.00% 3.4(47.7) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.44%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.61%
  • overwhelming_power_8:1.66%
  • overwhelming_power_9:1.71%
  • overwhelming_power_10:1.76%
  • overwhelming_power_11:1.81%
  • overwhelming_power_12:1.86%
  • overwhelming_power_13:1.91%
  • overwhelming_power_14:1.97%
  • overwhelming_power_15:2.03%
  • overwhelming_power_16:2.09%
  • overwhelming_power_17:2.15%
  • overwhelming_power_18:2.21%
  • overwhelming_power_19:2.28%
  • overwhelming_power_20:2.35%
  • overwhelming_power_21:2.42%
  • overwhelming_power_22:2.49%
  • overwhelming_power_23:2.57%
  • overwhelming_power_24:2.64%
  • overwhelming_power_25:1.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 9.0 78.5 28.5sec 3.5sec 96.61% 94.58% 4.3(4.3) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:13.16%
  • solar_empowerment_2:47.30%
  • solar_empowerment_3:36.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.8 56.5 19.6sec 4.2sec 98.36% 93.12% 25.2(25.2) 7.5

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:15.47%
  • starlord_2:21.64%
  • starlord_3:61.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.0sec 45.3sec 23.68% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.68%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
lucid dreams
starsurge Astral Power 72.2 2888.7 40.0 40.0 1466.7
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 85.19 790.55 (27.69%) 9.28 0.46 0.06%
celestial_alignment Astral Power 2.00 118.31 (4.14%) 59.16 1.68 1.40%
sunfire Astral Power 17.45 59.04 (2.07%) 3.38 0.00 0.00%
shooting_stars Astral Power 44.42 207.97 (7.28%) 4.68 0.22 0.10%
moonfire Astral Power 14.17 47.34 (1.66%) 3.34 0.00 0.00%
stellar_flare Astral Power 12.78 113.34 (3.97%) 8.87 0.04 0.04%
lunar_strike Astral Power 76.23 1011.21 (35.41%) 13.27 6.76 0.66%
lucid_dreams Astral Power 10.87 217.35 (7.61%) 20.00 0.00 0.00%
natures_balance Astral Power 400.43 200.06 (7.01%) 0.50 0.16 0.08%
arcanic_pulsar Astral Power 7.52 90.26 (3.16%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 9.52 9.63
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 24.02 0.00 78.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.1%

Statistics & Data Analysis

Fight Length
Sample Data lucid dreams Fight Length
Count 7600
Mean 299.94
Minimum 240.00
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data lucid dreams Damage Per Second
Count 7600
Mean 38026.86
Minimum 34092.36
Maximum 42897.47
Spread ( max - min ) 8805.11
Range [ ( max - min ) / 2 * 100% ] 11.58%
Standard Deviation 1237.2065
5th Percentile 36052.04
95th Percentile 40131.00
( 95th Percentile - 5th Percentile ) 4078.96
Mean Distribution
Standard Deviation 14.1917
95.00% Confidence Intervall ( 37999.04 - 38054.67 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4067
0.1 Scale Factor Error with Delta=300 13067
0.05 Scale Factor Error with Delta=300 52268
0.01 Scale Factor Error with Delta=300 1306677
Priority Target DPS
Sample Data lucid dreams Priority Target Damage Per Second
Count 7600
Mean 38026.86
Minimum 34092.36
Maximum 42897.47
Spread ( max - min ) 8805.11
Range [ ( max - min ) / 2 * 100% ] 11.58%
Standard Deviation 1237.2065
5th Percentile 36052.04
95th Percentile 40131.00
( 95th Percentile - 5th Percentile ) 4078.96
Mean Distribution
Standard Deviation 14.1917
95.00% Confidence Intervall ( 37999.04 - 38054.67 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4067
0.1 Scale Factor Error with Delta=300 13067
0.05 Scale Factor Error with Delta=300 52268
0.01 Scale Factor Error with Delta=300 1306677
DPS(e)
Sample Data lucid dreams Damage Per Second (Effective)
Count 7600
Mean 38026.86
Minimum 34092.36
Maximum 42897.47
Spread ( max - min ) 8805.11
Range [ ( max - min ) / 2 * 100% ] 11.58%
Damage
Sample Data lucid dreams Damage
Count 7600
Mean 11380244.66
Minimum 8892566.28
Maximum 14181325.02
Spread ( max - min ) 5288758.74
Range [ ( max - min ) / 2 * 100% ] 23.24%
DTPS
Sample Data lucid dreams Damage Taken Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data lucid dreams Healing Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data lucid dreams Healing Per Second (Effective)
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data lucid dreams Heal
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data lucid dreams Healing Taken Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data lucid dreams Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data lucid dreamsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data lucid dreams Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.93 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
H 2.87 memory_of_lucid_dreams,if=dot.sunfire.remains>10&dot.moonfire.remains>10&(astral_power<40|cooldown.ca_inc.remains>30)&dot.stellar_flare.remains>10&!buff.ca_inc.up
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&!buff.ca_inc.up
I 2.00 celestial_alignment,if=(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&!buff.ca_inc.up&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 7.33 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 72.22 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.12 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.50 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 13.98 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.67 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.78 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 76.41 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 84.44 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.35 sunfire

Sample Sequence

0123456789ACDKONPKHIFGKRQKRQKRQKRNKORJKRQKPRQKRQRSRKRQKMKRQRRJKQQKRQKRNPQKRQROJKRQRKRLQQKRRKPQJKRQORKNQQKRQQRJKKRPQKRQRKRLOQQRRQKKQQKNPRKORQKHRGQQJKRKNRQKRSRKRPMQKQQQJKRQKRQKNRQRKORPQQKRKRNQKRQKRQMRQRQJKKPNRIEFRKRQRKRQKRQORQRKRKRPRLQKRQKRQKQQQNORKRKRQPKRQRQRKGNRQOHKRQKRQKRQKKR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask lucid dreams 58.0/100: 58% astral_power
Pre precombat 1 food lucid dreams 58.0/100: 58% astral_power
Pre precombat 2 augmentation lucid dreams 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.248 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.181 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.114 default P stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.049 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.982 default H memory_of_lucid_dreams Fluffy_Pillow 7.0/100: 7% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:05.890 default I celestial_alignment Fluffy_Pillow 7.5/100: 8% astral_power bloodlust, memory_of_lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:06.678 default F berserking Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, memory_of_lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:06.678 default G use_items Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:06.678 default K starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.431 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.186 default Q lunar_strike Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.039 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.792 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:10.549 default Q lunar_strike Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:11.402 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.156 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.909 default Q lunar_strike Fluffy_Pillow 76.5/100: 77% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.729 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.484 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.239 default N sunfire Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.995 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.748 default O moonfire Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.502 default R solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.256 default J cancel_buff Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.256 default K starsurge Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.011 default R solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power bloodlust, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.766 default Q lunar_strike Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.652 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power bloodlust, lucid_dreams, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.406 default P stellar_flare Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, lucid_dreams, celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(2), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.162 default R solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power bloodlust, lucid_dreams, celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(2), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.916 default Q lunar_strike Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, lucid_dreams, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.745 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power bloodlust, lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), ignition_mages_fuse(5)
0:24.498 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), ignition_mages_fuse(5)
0:25.253 default Q lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power bloodlust, lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), ignition_mages_fuse(5)
0:26.062 default R solar_wrath Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), ignition_mages_fuse(5)
0:26.813 default S sunfire Fluffy_Pillow 84.5/100: 85% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:27.580 default R solar_wrath Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:28.335 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
0:29.103 default R solar_wrath Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3)
0:29.857 default Q lunar_strike Fluffy_Pillow 85.5/100: 86% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3)
0:30.836 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
0:31.605 default M moonfire Fluffy_Pillow 84.5/100: 85% astral_power bloodlust, lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3)
0:32.372 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, lucid_dreams, arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3)
0:33.255 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(3), starlord(3)
0:34.010 default Q lunar_strike Fluffy_Pillow 61.0/100: 61% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3)
0:35.135 default R solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:35.891 default R solar_wrath Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:36.645 default J cancel_buff Fluffy_Pillow 94.5/100: 95% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord(3)
0:36.645 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment
0:37.607 default Q lunar_strike Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, lucid_dreams, arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord
0:38.794 default Q lunar_strike Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord
0:39.981 default K starsurge Fluffy_Pillow 85.0/100: 85% astral_power bloodlust, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord
0:40.915 default R solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power bloodlust, lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2)
0:41.687 default Q lunar_strike Fluffy_Pillow 78.0/100: 78% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2)
0:43.188 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2)
0:44.365 default R solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:45.339 default N sunfire Fluffy_Pillow 60.5/100: 61% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:46.486 default P stellar_flare Fluffy_Pillow 64.0/100: 64% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:47.632 default Q lunar_strike Fluffy_Pillow 73.0/100: 73% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:49.091 default K starsurge Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3)
0:50.235 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:51.210 default Q lunar_strike Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3)
0:52.668 default R solar_wrath Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:53.642 default O moonfire Fluffy_Pillow 85.0/100: 85% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:54.788 default J cancel_buff Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:54.788 default K starsurge Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2)
0:56.035 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord
0:56.931 default Q lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord
0:58.272 default R solar_wrath Fluffy_Pillow 87.0/100: 87% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord
0:59.170 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord
1:00.223 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2)
1:01.095 default L sunfire Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2)
1:02.117 default Q lunar_strike Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(2)
1:03.620 default Q lunar_strike Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:05.119 default K starsurge Fluffy_Pillow 98.5/100: 99% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(3), starlord(2)
1:06.300 default R solar_wrath Fluffy_Pillow 79.5/100: 80% astral_power lucid_dreams, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:07.272 default R solar_wrath Fluffy_Pillow 88.0/100: 88% astral_power lucid_dreams, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:08.246 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power lucid_dreams, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements
1:09.391 default P stellar_flare Fluffy_Pillow 77.5/100: 78% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements
1:10.536 default Q lunar_strike Fluffy_Pillow 86.5/100: 87% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements
1:11.996 default J cancel_buff Fluffy_Pillow 99.0/100: 99% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
1:11.996 default K starsurge Fluffy_Pillow 99.0/100: 99% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), torrent_of_elements
1:13.247 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(3), starlord, torrent_of_elements
1:14.279 default Q lunar_strike Fluffy_Pillow 69.0/100: 69% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord, torrent_of_elements
1:15.824 default O moonfire Fluffy_Pillow 82.0/100: 82% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements
1:17.036 default R solar_wrath Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements
1:18.065 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements
1:19.278 default N sunfire Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements
1:20.454 default Q lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements
1:21.954 default Q lunar_strike Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
1:23.455 default K starsurge Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements
1:24.633 default R solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
1:25.608 default Q lunar_strike Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
1:27.068 default Q lunar_strike Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
1:28.527 default R solar_wrath Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements
1:29.500 default J cancel_buff Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements
1:29.500 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(6), solar_empowerment, torrent_of_elements
1:30.749 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord
1:31.962 default R solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2)
1:32.963 default P stellar_flare Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:34.140 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:35.642 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2)
1:36.819 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:37.667 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:38.936 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3)
1:39.782 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3)
1:40.778 default R solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:41.625 default L sunfire Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
1:42.621 default O moonfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3)
1:43.766 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3)
1:45.225 default Q lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24)
1:46.563 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(23)
1:47.460 default R solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar, starlord(3), overwhelming_power(22)
1:48.518 default Q lunar_strike Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(21)
1:49.870 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar, torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers
1:51.031 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers
1:52.168 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers
1:53.577 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(16), conch_of_dark_whispers
1:54.992 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(15), conch_of_dark_whispers
1:56.105 default N sunfire Fluffy_Pillow 20.5/100: 21% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(13), conch_of_dark_whispers
1:57.198 default P stellar_flare Fluffy_Pillow 24.5/100: 25% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(12), conch_of_dark_whispers
1:58.296 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(11), conch_of_dark_whispers
1:59.232 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10), conch_of_dark_whispers
2:00.336 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(9), conch_of_dark_whispers
2:01.444 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(8), conch_of_dark_whispers
2:02.388 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(7), conch_of_dark_whispers
2:03.810 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(6), conch_of_dark_whispers
2:04.931 default H memory_of_lucid_dreams Fluffy_Pillow 12.5/100: 13% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(5)
2:06.105 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(3)
2:07.067 default G use_items Fluffy_Pillow 38.0/100: 38% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(2)
2:07.067 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(2), ignition_mages_fuse
2:08.456 default Q lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power memory_of_lucid_dreams, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power, ignition_mages_fuse
2:09.851 default J cancel_buff Fluffy_Pillow 96.0/100: 96% astral_power memory_of_lucid_dreams, arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse
2:09.851 default K starsurge Fluffy_Pillow 96.0/100: 96% astral_power memory_of_lucid_dreams, arcanic_pulsar(6), solar_empowerment(2), torrent_of_elements, ignition_mages_fuse
2:11.049 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power memory_of_lucid_dreams, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, ignition_mages_fuse
2:12.036 default K starsurge Fluffy_Pillow 73.5/100: 74% astral_power memory_of_lucid_dreams, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, ignition_mages_fuse(2)
2:13.152 default N sunfire Fluffy_Pillow 34.0/100: 34% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, ignition_mages_fuse(2)
2:14.239 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, ignition_mages_fuse(2)
2:15.164 default Q lunar_strike Fluffy_Pillow 57.5/100: 57% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, ignition_mages_fuse(3)
2:16.497 default K starsurge Fluffy_Pillow 82.0/100: 82% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, ignition_mages_fuse(3)
2:17.545 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power memory_of_lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, ignition_mages_fuse(3)
2:18.300 default S sunfire Fluffy_Pillow 71.5/100: 72% astral_power memory_of_lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(3)
2:19.183 default R solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power memory_of_lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(4)
2:19.938 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power memory_of_lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, ignition_mages_fuse(4)
2:20.791 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(4)
2:21.547 default P stellar_flare Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, ignition_mages_fuse(4)
2:22.399 default M moonfire Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, ignition_mages_fuse(4)
2:23.251 default Q lunar_strike Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, ignition_mages_fuse(5)
2:24.455 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), ignition_mages_fuse(5)
2:25.400 default Q lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), ignition_mages_fuse(5)
2:26.605 default Q lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(5)
2:27.811 default Q lunar_strike Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
2:29.271 default J cancel_buff Fluffy_Pillow 92.0/100: 92% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), torrent_of_elements
2:29.271 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power arcanic_pulsar(2), solar_empowerment(2), torrent_of_elements
2:30.519 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements
2:31.550 default Q lunar_strike Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements
2:33.096 default K starsurge Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements
2:34.310 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements
2:35.311 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
2:36.811 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
2:37.988 default N sunfire Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
2:39.133 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
2:40.106 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
2:41.566 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
2:42.541 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
2:43.684 default O moonfire Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3)
2:44.830 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3)
2:45.804 default P stellar_flare Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3)
2:46.950 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3)
2:48.409 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
2:49.867 default K starsurge Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(6), solar_empowerment(2)
2:51.117 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord
2:52.148 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord
2:53.361 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2)
2:54.361 default N sunfire Fluffy_Pillow 26.5/100: 27% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2)
2:55.538 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2)
2:57.040 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2)
2:58.220 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3)
2:59.066 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:00.334 default K starsurge Fluffy_Pillow 61.5/100: 62% astral_power lucid_dreams, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3)
3:01.329 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3)
3:02.174 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:03.443 default M moonfire Fluffy_Pillow 43.5/100: 44% astral_power lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3)
3:04.441 default R solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power lucid_dreams, arcanic_pulsar, lunar_empowerment, solar_empowerment(3), starlord(3)
3:05.415 default Q lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3)
3:06.874 default R solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3)
3:07.847 default Q lunar_strike Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3)
3:09.306 default J cancel_buff Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar, solar_empowerment, starlord(3)
3:09.306 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar, solar_empowerment
3:10.554 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord
3:11.767 default P stellar_flare Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2)
3:12.944 default N sunfire Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2)
3:14.120 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2)
3:15.120 default I celestial_alignment Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2)
3:16.144 default E potion Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2)
3:16.144 default F berserking Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
3:16.144 default R solar_wrath Fluffy_Pillow 82.0/100: 82% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
3:16.935 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect
3:17.868 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:18.640 default Q lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect
3:19.792 default R solar_wrath Fluffy_Pillow 76.5/100: 77% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:20.564 default K starsurge Fluffy_Pillow 85.0/100: 85% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect
3:21.472 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:22.241 default Q lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(25), battle_potion_of_intellect
3:23.294 default K starsurge Fluffy_Pillow 71.0/100: 71% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24), battle_potion_of_intellect
3:24.125 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(23), battle_potion_of_intellect
3:24.879 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(25), battle_potion_of_intellect
3:25.933 default O moonfire Fluffy_Pillow 52.5/100: 53% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24), battle_potion_of_intellect
3:26.763 default R solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(23), battle_potion_of_intellect
3:27.519 default Q lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(22), battle_potion_of_intellect
3:28.584 default R solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(21), battle_potion_of_intellect
3:29.508 default K starsurge Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, overwhelming_power(20), battle_potion_of_intellect
3:30.517 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(19), battle_potion_of_intellect
3:31.354 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(25), battle_potion_of_intellect
3:32.317 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power lucid_dreams, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(24), battle_potion_of_intellect
3:33.115 default P stellar_flare Fluffy_Pillow 44.5/100: 45% astral_power lucid_dreams, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(23), battle_potion_of_intellect
3:34.059 default R solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power lucid_dreams, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(22), battle_potion_of_intellect
3:35.006 default L sunfire Fluffy_Pillow 61.5/100: 62% astral_power lucid_dreams, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(21), battle_potion_of_intellect
3:35.955 default Q lunar_strike Fluffy_Pillow 65.0/100: 65% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment(3), starlord(2), overwhelming_power(21), battle_potion_of_intellect
3:37.347 default K starsurge Fluffy_Pillow 78.0/100: 78% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(19), battle_potion_of_intellect
3:38.446 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(18), battle_potion_of_intellect
3:39.238 default Q lunar_strike Fluffy_Pillow 59.5/100: 60% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(17), battle_potion_of_intellect
3:40.433 default K starsurge Fluffy_Pillow 76.0/100: 76% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(16), battle_potion_of_intellect
3:41.373 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(15)
3:42.175 default Q lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(14)
3:43.379 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(13)
3:44.330 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(12)
3:45.727 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(11)
3:47.129 default Q lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(9)
3:48.541 default N sunfire Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(2), solar_empowerment(3), starlord(3), overwhelming_power(8)
3:49.656 default O moonfire Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(2), solar_empowerment(3), overwhelming_power(7)
3:50.873 default R solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(2), solar_empowerment(3), overwhelming_power(6)
3:51.914 default K starsurge Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(2), solar_empowerment(2), overwhelming_power(5)
3:53.140 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(3)
3:54.158 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(2)
3:55.361 default R solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power
3:56.360 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2)
3:57.861 default P stellar_flare Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2)
3:59.038 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2)
4:00.214 default R solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3)
4:01.187 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3)
4:02.647 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3)
4:03.621 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3)
4:05.079 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3)
4:06.053 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3)
4:07.197 default G use_items Fluffy_Pillow 40.0/100: 40% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3)
4:07.197 default N sunfire Fluffy_Pillow 40.0/100: 40% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), ignition_mages_fuse
4:08.295 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse
4:09.231 default Q lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse
4:10.632 default O moonfire Fluffy_Pillow 65.5/100: 66% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse
4:11.732 default H memory_of_lucid_dreams Fluffy_Pillow 69.0/100: 69% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(2)
4:12.787 default K starsurge Fluffy_Pillow 70.0/100: 70% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), conch_of_dark_whispers, ignition_mages_fuse(2)
4:13.940 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord, conch_of_dark_whispers, ignition_mages_fuse(2)
4:14.889 default Q lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power memory_of_lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord, conch_of_dark_whispers, ignition_mages_fuse(2)
4:16.313 default K starsurge Fluffy_Pillow 72.0/100: 72% astral_power memory_of_lucid_dreams, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, conch_of_dark_whispers, ignition_mages_fuse(3)
4:17.388 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), conch_of_dark_whispers, ignition_mages_fuse(3)
4:18.276 default Q lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers, ignition_mages_fuse(3)
4:19.607 default K starsurge Fluffy_Pillow 74.5/100: 75% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers, ignition_mages_fuse(4)
4:20.617 default R solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power memory_of_lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
4:21.369 default Q lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power memory_of_lucid_dreams, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
4:22.454 default K starsurge Fluffy_Pillow 88.0/100: 88% astral_power memory_of_lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
4:23.306 default K starsurge Fluffy_Pillow 77.0/100: 77% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(5)
4:24.129 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(5)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="lucid dreams"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams,if=dot.sunfire.remains>10&dot.moonfire.remains>10&(astral_power<40|cooldown.ca_inc.remains>30)&dot.stellar_flare.remains>10&!buff.ca_inc.up
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&!buff.ca_inc.up
actions+=/celestial_alignment,if=(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&!buff.ca_inc.up&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

purification protocol : 36005 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
36005.2 36005.2 25.6 / 0.071% 4407.8 / 12.2% 4456.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 7.9 Astral Power 0.00% 57.9 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
purification protocol 36005
Heed My Call 292 (417) 0.8% (1.2%) 8.1 33.47sec 15359 0 Direct 8.1 9106 18224 10751 18.0%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.14 8.14 0.00 0.00 0.0000 0.0000 87497.37 87497.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.67 81.96% 9106.37 8901 9791 9103.59 0 9791 60747 60747 0.00
crit 1.47 18.04% 18223.68 17802 19582 14238.20 0 19582 26751 26751 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 125 0.3% 8.1 33.47sec 4608 0 Direct 8.1 3903 7805 4608 18.1%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.14 8.14 0.00 0.00 0.0000 0.0000 37503.44 37503.44 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.67 81.94% 3903.27 3815 4196 3901.78 0 4196 26030 26030 0.00
crit 1.47 18.06% 7805.28 7629 8392 6076.68 0 8392 11474 11474 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 4967 13.8% 76.1 3.85sec 19566 14946 Direct 76.1 16596 33162 19567 17.9%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.06 76.06 0.00 0.00 1.3092 0.0000 1488249.91 1488249.91 0.00 14945.72 14945.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.42 82.07% 16595.79 8882 21253 16602.87 16042 17568 1035952 1035952 0.00
crit 13.64 17.93% 33161.90 17765 42507 33178.24 29788 37973 452298 452298 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2442 6.8% 14.1 21.31sec 51921 50800 Direct 14.1 2855 5709 3370 18.1%  
Periodic 220.8 2628 5253 3098 17.9% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.09 14.09 220.76 220.76 1.0221 1.3442 731424.86 731424.86 0.00 2350.67 50800.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.54 81.94% 2854.65 2589 3565 2856.56 2617 3119 32952 32952 0.00
crit 2.54 18.06% 5708.58 5177 7129 5349.66 0 7129 14522 14522 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.2 82.08% 2627.90 2 3319 2629.15 2546 2750 476206 476206 0.00
crit 39.6 17.92% 5252.70 3 6638 5254.72 4917 5721 207745 207745 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Purification Protocol 604 1.7% 16.5 17.42sec 10970 0 Direct 16.5 9292 18589 10970 18.0%  

Stats details: purification_protocol

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.51 16.51 0.00 0.00 0.0000 0.0000 181164.82 181164.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.53 81.95% 9292.44 9083 9991 9292.30 9083 9862 125758 125758 0.00
crit 2.98 18.05% 18588.57 18166 19983 17640.03 0 19983 55407 55407 0.00
 
 

Action details: purification_protocol

Static Values
  • id:295293
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295293
  • name:Purification Protocol
  • school:physical
  • tooltip:
  • description:MOTHER has added a Purification Protocol to your Heart of Azeroth, allowing your damaging spells and abilities to release a blast of Azerite energy at your target, dealing ${{$s1=1920}*(1+$@versadmg)} Fire damage to any enemy within $295305A2 yds$?a295363[, and heals you for ${{$295293s4=869}*(1+$@versadmg)} every $295310t1 sec for {$295310d=8 seconds}][]. Purification Protocol deals {$s2=50}% additional damage against Aberrations.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8271.92
  • base_dd_max:8271.92
  • base_dd_mult:1.00
 
Purifying Blast 0 (676) 0.0% (1.9%) 5.5 60.37sec 36952 32232

Stats details: purifying_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.47 0.00 0.00 0.00 1.1466 0.0000 0.00 0.00 0.00 32231.70 32231.70
 
 

Action details: purifying_blast

Static Values
  • id:295337
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295337
  • name:Purifying Blast
  • school:physical
  • tooltip:
  • description:Call down a purifying beam upon the target area, dealing ${{$295293s3=1173}*(1+$@versadmg)*{$s2=7}} Fire damage over {$d=6 seconds}.$?a295364[ Has a low chance to immediately annihilate any specimen deemed unworthy by MOTHER.][]$?a295352[ When an enemy dies within the beam, your damage is increased by {$295354s1=10}% for {$295354d=8 seconds}.][] Any Aberration struck by the beam is stunned for {$295366d=3 seconds}.
 
    Purifying Blast (purifying_tick) 676 1.9% 38.0 7.64sec 5328 0 Periodic 38.0 4532 9067 5328 17.6% 0.0%

Stats details: purifying_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.95 0.00 0.00 37.95 0.0000 0.0000 202221.68 202221.68 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.3 82.44% 4531.67 4441 4885 4531.54 4441 4801 141794 141794 0.00
crit 6.7 17.56% 9066.98 8881 9769 9057.79 0 9769 60428 60428 0.00
 
 

Action details: purifying_tick

Static Values
  • id:295338
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295338
  • name:Purifying Blast
  • school:fire
  • tooltip:
  • description:{$@spelldesc295337=Call down a purifying beam upon the target area, dealing ${{$295293s3=1173}*(1+$@versadmg)*{$s2=7}} Fire damage over {$d=6 seconds}.$?a295364[ Has a low chance to immediately annihilate any specimen deemed unworthy by MOTHER.][]$?a295352[ When an enemy dies within the beam, your damage is increased by {$295354s1=10}% for {$295354d=8 seconds}.][] Any Aberration struck by the beam is stunned for {$295366d=3 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4043.71
  • base_dd_max:4043.71
  • base_dd_mult:1.00
 
Shooting Stars 791 2.2% 44.0 6.64sec 5382 0 Direct 44.0 4560 9121 5382 18.0%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.01 44.01 0.00 0.00 0.0000 0.0000 236845.45 236845.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.08 81.98% 4560.15 4180 5756 4562.22 4271 5004 164512 164512 0.00
crit 7.93 18.02% 9121.07 8360 11513 9118.65 0 11513 72334 72334 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2764 (4378) 7.7% (12.2%) 91.4 3.21sec 14351 15923 Direct 91.9 7642 15269 9009 17.9%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.39 91.91 0.00 0.00 0.9013 0.0000 827979.23 827979.23 0.00 15923.31 15923.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.44 82.08% 7641.88 6967 9594 7646.43 7364 8046 576502 576502 0.00
crit 16.47 17.92% 15269.38 13933 19188 15280.09 13933 17016 251477 251477 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1614 4.5% 73.3 3.99sec 6594 0 Direct 73.3 6594 0 6594 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.34 73.34 0.00 0.00 0.0000 0.0000 483575.74 483575.74 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.34 100.00% 6593.82 5086 14007 6597.31 5728 7656 483576 483576 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5085.61
  • base_dd_max:5085.61
  • base_dd_mult:1.00
 
Starsurge 11678 32.5% 60.4 4.99sec 57857 55046 Direct 60.3 49248 98425 58033 17.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.44 60.26 0.00 0.00 1.0511 0.0000 3496929.65 3496929.65 0.00 55046.35 55046.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.49 82.14% 49248.45 45067 61614 49272.76 47325 51974 2437509 2437509 0.00
crit 10.76 17.86% 98424.69 90135 123227 98452.09 90135 112257 1059421 1059421 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1585 4.4% 12.7 23.57sec 37255 35861 Direct 12.7 2395 4796 2829 18.0%  
Periodic 218.4 1703 3404 2009 18.0% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.74 12.74 218.43 218.43 1.0389 1.3469 474765.41 474765.41 0.00 1544.25 35861.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.44 81.95% 2395.28 2231 3073 2396.22 2231 2668 25015 25015 0.00
crit 2.30 18.05% 4796.21 4463 6146 4408.46 0 6146 11032 11032 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 179.2 82.04% 1703.09 1 2151 1703.90 1654 1782 305176 305176 0.00
crit 39.2 17.96% 3403.50 10 4302 3404.95 3202 3736 133542 133542 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5746 15.9% 88.7 3.13sec 19290 0 Direct 88.7 16351 32709 19290 18.0%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.73 88.73 0.00 0.00 0.0000 0.0000 1711518.20 1711518.20 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.79 82.03% 16351.09 15985 17583 16351.16 15985 17278 1190134 1190134 0.00
crit 15.94 17.97% 32708.63 31970 35167 32709.40 31970 34979 521384 521384 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2720 7.6% 18.0 16.60sec 45389 44212 Direct 18.0 3914 7827 4618 18.0%  
Periodic 219.9 2823 5641 3328 17.9% 98.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.95 17.95 219.92 219.92 1.0266 1.3453 814790.65 814790.65 0.00 2592.55 44212.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.72 82.01% 3913.81 3570 4917 3914.66 3632 4251 57619 57619 0.00
crit 3.23 17.99% 7827.05 7141 9834 7562.31 0 9834 25274 25274 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.5 82.06% 2822.50 11 3565 2823.86 2749 2950 509396 509396 0.00
crit 39.4 17.94% 5640.97 49 7129 5643.00 5293 6114 222501 222501 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
purification protocol
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:purification protocol
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.48sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.16sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9046 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:purification protocol
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:purification protocol
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.1 53.1 44.7sec 5.0sec 92.81% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.32%
  • arcanic_pulsar_2:10.31%
  • arcanic_pulsar_3:11.28%
  • arcanic_pulsar_4:10.62%
  • arcanic_pulsar_5:13.72%
  • arcanic_pulsar_6:10.35%
  • arcanic_pulsar_7:10.89%
  • arcanic_pulsar_8:14.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 189.1sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.5sec 182.5sec 8.11% 7.68% 0.0(0.0) 2.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.6sec 37.6sec 25.76% 32.50% 0.0(0.0) 8.1

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.1sec 45.4sec 23.72% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.17% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.94%
  • ignition_mages_fuse_2:3.88%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 33.5 45.4 9.0sec 3.8sec 81.91% 99.69% 1.8(1.8) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.21%
  • lunar_empowerment_2:31.64%
  • lunar_empowerment_3:14.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.5 3.4 64.6sec 34.1sec 47.62% 0.00% 3.4(47.6) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.44%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.66%
  • overwhelming_power_9:1.71%
  • overwhelming_power_10:1.75%
  • overwhelming_power_11:1.81%
  • overwhelming_power_12:1.86%
  • overwhelming_power_13:1.91%
  • overwhelming_power_14:1.97%
  • overwhelming_power_15:2.03%
  • overwhelming_power_16:2.09%
  • overwhelming_power_17:2.15%
  • overwhelming_power_18:2.21%
  • overwhelming_power_19:2.28%
  • overwhelming_power_20:2.34%
  • overwhelming_power_21:2.41%
  • overwhelming_power_22:2.49%
  • overwhelming_power_23:2.56%
  • overwhelming_power_24:2.63%
  • overwhelming_power_25:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 24.3 51.3 12.1sec 4.0sec 85.75% 79.93% 0.3(0.3) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.06%
  • solar_empowerment_2:39.63%
  • solar_empowerment_3:18.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.3 20.3sec 5.0sec 97.03% 92.07% 15.4(15.4) 11.5

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.91%
  • starlord_2:22.46%
  • starlord_3:59.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.4sec 45.6sec 23.58% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.58%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
purification protocol
starsurge Astral Power 60.4 2417.6 40.0 40.0 1446.4
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 92.39 739.04 (31.05%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.36%) 40.00 0.00 0.00%
sunfire Astral Power 17.95 53.85 (2.26%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.01 176.02 (7.39%) 4.00 0.01 0.01%
moonfire Astral Power 14.09 42.26 (1.78%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.74 101.95 (4.28%) 8.00 0.00 0.00%
lunar_strike Astral Power 76.06 912.70 (38.34%) 12.00 0.06 0.01%
natures_balance Astral Power 400.43 200.21 (8.41%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.20 74.36 (3.12%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.94 8.06
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.25 0.00 83.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data purification protocol Fight Length
Count 7600
Mean 299.94
Minimum 240.00
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data purification protocol Damage Per Second
Count 7600
Mean 36005.16
Minimum 32501.61
Maximum 41160.06
Spread ( max - min ) 8658.45
Range [ ( max - min ) / 2 * 100% ] 12.02%
Standard Deviation 1140.3266
5th Percentile 34239.26
95th Percentile 37962.52
( 95th Percentile - 5th Percentile ) 3723.26
Mean Distribution
Standard Deviation 13.0804
95.00% Confidence Intervall ( 35979.52 - 36030.80 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3854
0.1 Scale Factor Error with Delta=300 11101
0.05 Scale Factor Error with Delta=300 44402
0.01 Scale Factor Error with Delta=300 1110050
Priority Target DPS
Sample Data purification protocol Priority Target Damage Per Second
Count 7600
Mean 36005.16
Minimum 32501.61
Maximum 41160.06
Spread ( max - min ) 8658.45
Range [ ( max - min ) / 2 * 100% ] 12.02%
Standard Deviation 1140.3266
5th Percentile 34239.26
95th Percentile 37962.52
( 95th Percentile - 5th Percentile ) 3723.26
Mean Distribution
Standard Deviation 13.0804
95.00% Confidence Intervall ( 35979.52 - 36030.80 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3854
0.1 Scale Factor Error with Delta=300 11101
0.05 Scale Factor Error with Delta=300 44402
0.01 Scale Factor Error with Delta=300 1110050
DPS(e)
Sample Data purification protocol Damage Per Second (Effective)
Count 7600
Mean 36005.16
Minimum 32501.61
Maximum 41160.06
Spread ( max - min ) 8658.45
Range [ ( max - min ) / 2 * 100% ] 12.02%
Damage
Sample Data purification protocol Damage
Count 7600
Mean 10774466.43
Minimum 8437144.15
Maximum 13538689.85
Spread ( max - min ) 5101545.71
Range [ ( max - min ) / 2 * 100% ] 23.67%
DTPS
Sample Data purification protocol Damage Taken Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data purification protocol Healing Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data purification protocol Healing Per Second (Effective)
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data purification protocol Heal
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data purification protocol Healing Taken Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data purification protocol Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data purification protocolTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data purification protocol Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.94 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
H 5.47 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 thorns
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.76 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 60.44 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.07 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.75 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.51 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.33 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.74 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 76.43 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 91.65 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.37 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRKRQRKRQRQKRNRQORQRQKPKRLQKRQQRRRRKRKRKRQRMQQKNQKPQRKQRRRKQRHNORKQRQKPQRRKRQKRQLROKQRRKQRPQKNQRRQRRKOKQQRQKNPQHRQRRGRKKORQKRQLQKRQQRKPRQQRKQKNORQRKQQRKQRRPRKNQORKRQRKHLQRIEFKRQRKPKRQOKRQRQKRQRKLQQRKQRQPKORQKRLQQRRQRKKQQKNROPQHRKRQGRRRKQRKNQQRKQRQR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask purification protocol 58.0/100: 58% astral_power
Pre precombat 1 food purification protocol 58.0/100: 58% astral_power
Pre precombat 2 augmentation purification protocol 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H purifying_blast Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.249 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, battle_potion_of_intellect
0:02.211 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.144 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.077 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.010 default I celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.822 default F berserking Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.822 default G use_items Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.822 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:06.575 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.331 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.085 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.838 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.690 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:10.445 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.199 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.953 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.772 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.526 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.345 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(25), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.102 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.856 default N sunfire Fluffy_Pillow 18.5/100: 19% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.611 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.366 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.120 default O moonfire Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.874 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.628 default Q lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.414 default R solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.168 default Q lunar_strike Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.959 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, solar_empowerment, overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.715 default P stellar_flare Fluffy_Pillow 61.0/100: 61% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.469 default K starsurge Fluffy_Pillow 73.5/100: 74% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(16), ignition_mages_fuse(5)
0:24.223 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(15), ignition_mages_fuse(5)
0:24.977 default L sunfire Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(15), ignition_mages_fuse(5)
0:25.730 default Q lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(14), ignition_mages_fuse(5)
0:26.644 default K starsurge Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(13)
0:27.508 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(12)
0:28.263 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(11)
0:29.339 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(25)
0:30.365 default R solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(24)
0:31.119 default R solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(23)
0:31.875 default R solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(23)
0:32.686 default R solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(22)
0:33.500 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(21)
0:34.319 default R solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20)
0:35.073 default K starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24)
0:35.828 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24)
0:36.583 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23)
0:37.338 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25)
0:38.092 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(24)
0:38.987 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24)
0:39.740 default M moonfire Fluffy_Pillow 39.0/100: 39% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(25)
0:40.494 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24)
0:41.522 default Q lunar_strike Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23)
0:42.864 default K starsurge Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(2), torrent_of_elements, overwhelming_power(22)
0:44.017 default N sunfire Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(20)
0:45.145 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(19)
0:46.586 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(3), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(18)
0:47.722 default P stellar_flare Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(17)
0:48.829 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(16)
0:50.245 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(14)
0:51.195 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), overwhelming_power(13)
0:52.319 default Q lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12)
0:53.714 default R solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(11)
0:54.649 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(10)
0:55.591 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(9)
0:56.700 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(8)
0:57.813 default Q lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(7)
0:59.235 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(5)
1:00.190 default H purifying_blast Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(4), conch_of_dark_whispers
1:01.318 default N sunfire Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(3), conch_of_dark_whispers
1:02.449 default O moonfire Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(2), conch_of_dark_whispers
1:03.587 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(6), solar_empowerment, overwhelming_power, conch_of_dark_whispers
1:04.645 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(6), conch_of_dark_whispers
1:05.893 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
1:07.439 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(7), solar_empowerment, starlord, conch_of_dark_whispers
1:08.469 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(7), lunar_empowerment, starlord, conch_of_dark_whispers
1:10.014 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(7), starlord, conch_of_dark_whispers
1:11.226 default P stellar_flare Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), conch_of_dark_whispers
1:12.402 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), conch_of_dark_whispers
1:13.903 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:14.905 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), conch_of_dark_whispers
1:15.907 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(8), starlord(2), conch_of_dark_whispers
1:17.085 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
1:17.933 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power celestial_alignment, lunar_empowerment, starlord(3), conch_of_dark_whispers
1:19.204 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power celestial_alignment, starlord(3), torrent_of_elements, conch_of_dark_whispers
1:20.203 default R solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
1:21.050 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements
1:22.319 default L sunfire Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, celestial_alignment, starlord(3), torrent_of_elements
1:23.315 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar, starlord(3), torrent_of_elements
1:24.460 default O moonfire Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, starlord(3), torrent_of_elements
1:25.605 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, torrent_of_elements
1:26.853 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
1:28.397 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord, torrent_of_elements
1:29.427 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(2), solar_empowerment, starlord, torrent_of_elements
1:30.456 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(2), starlord, torrent_of_elements
1:31.670 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements
1:33.171 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2), torrent_of_elements
1:34.172 default P stellar_flare Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(2), torrent_of_elements
1:35.348 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(2), torrent_of_elements
1:36.850 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(3), starlord(2), torrent_of_elements
1:38.027 default N sunfire Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
1:39.173 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
1:40.634 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), torrent_of_elements
1:41.608 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(4), starlord(3)
1:42.753 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(4), lunar_empowerment, starlord(3)
1:44.211 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(4), starlord(3), conch_of_dark_whispers
1:45.357 default R solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(4), starlord(3), torrent_of_elements, conch_of_dark_whispers
1:46.503 default K starsurge Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(4), torrent_of_elements, conch_of_dark_whispers
1:47.752 default O moonfire Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers
1:48.967 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers
1:50.178 default Q lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
1:51.678 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
1:53.177 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
1:54.179 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers
1:55.677 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers
1:56.855 default N sunfire Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
1:58.000 default P stellar_flare Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
1:59.146 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:00.606 default H purifying_blast Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:01.751 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:02.725 default Q lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
2:04.185 default R solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(24), conch_of_dark_whispers
2:05.079 default R solar_wrath Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(23), conch_of_dark_whispers
2:06.134 default G use_items Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(22), conch_of_dark_whispers
2:06.134 default R solar_wrath Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(22), conch_of_dark_whispers, ignition_mages_fuse
2:07.152 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(7), overwhelming_power(21), conch_of_dark_whispers, ignition_mages_fuse
2:08.267 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(20), conch_of_dark_whispers, ignition_mages_fuse
2:09.352 default O moonfire Fluffy_Pillow 22.0/100: 22% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(19), conch_of_dark_whispers, ignition_mages_fuse
2:10.274 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(18), conch_of_dark_whispers, ignition_mages_fuse(2)
2:11.030 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(17), ignition_mages_fuse(2)
2:12.164 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(16), ignition_mages_fuse(2)
2:13.060 default R solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(15), ignition_mages_fuse(2)
2:13.814 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(15), ignition_mages_fuse(2)
2:14.925 default L sunfire Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(14), ignition_mages_fuse(3)
2:15.770 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(13), ignition_mages_fuse(3)
2:17.011 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.953 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(24), conch_of_dark_whispers, ignition_mages_fuse(3)
2:18.754 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers, ignition_mages_fuse(4)
2:19.916 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers, ignition_mages_fuse(4)
2:21.082 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers, ignition_mages_fuse(4)
2:21.865 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers, ignition_mages_fuse(4)
2:22.787 default P stellar_flare Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers, ignition_mages_fuse(5)
2:23.680 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers, ignition_mages_fuse(5)
2:24.443 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers, ignition_mages_fuse(5)
2:25.585 default Q lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16), conch_of_dark_whispers, ignition_mages_fuse(5)
2:26.731 default R solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15), conch_of_dark_whispers
2:27.654 default K starsurge Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(3), solar_empowerment, torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers
2:28.839 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(13), conch_of_dark_whispers
2:30.310 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(11), conch_of_dark_whispers
2:31.473 default N sunfire Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(10), conch_of_dark_whispers
2:32.608 default O moonfire Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(9)
2:33.748 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(8)
2:34.720 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(7)
2:36.181 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(5)
2:37.167 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(4)
2:38.327 default Q lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(3)
2:39.771 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(2)
2:41.220 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3)
2:42.192 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3)
2:43.337 default Q lunar_strike Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3)
2:44.796 default R solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(3)
2:45.771 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3)
2:46.745 default P stellar_flare Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3)
2:47.890 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(7), solar_empowerment
2:48.950 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(7)
2:50.198 default N sunfire Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord
2:51.411 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord
2:52.954 default O moonfire Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(8), solar_empowerment, starlord, torrent_of_elements
2:54.166 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(8), solar_empowerment, starlord, torrent_of_elements
2:55.197 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(8), starlord, torrent_of_elements
2:56.409 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements
2:57.281 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power celestial_alignment, lunar_empowerment, starlord(2), torrent_of_elements
2:58.585 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power celestial_alignment, starlord(2), torrent_of_elements
2:59.609 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power celestial_alignment, starlord(2), torrent_of_elements
3:00.634 default H purifying_blast Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
3:01.630 default L sunfire Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
3:02.626 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
3:04.085 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24)
3:04.979 default I celestial_alignment Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, overwhelming_power(24)
3:05.927 default E potion Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar, celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(23)
3:05.927 default F berserking Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar, celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(23), battle_potion_of_intellect
3:05.927 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(23), battle_potion_of_intellect
3:06.762 default R solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), battle_potion_of_intellect
3:07.516 default Q lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21), battle_potion_of_intellect
3:08.588 default R solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power berserking, arcanic_pulsar(2), celestial_alignment, starlord(3), overwhelming_power(20), battle_potion_of_intellect
3:09.432 default K starsurge Fluffy_Pillow 83.0/100: 83% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, overwhelming_power(19), battle_potion_of_intellect
3:10.352 default P stellar_flare Fluffy_Pillow 47.5/100: 48% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(18), battle_potion_of_intellect
3:11.251 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(17), battle_potion_of_intellect
3:12.154 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(16), battle_potion_of_intellect
3:12.908 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(16), battle_potion_of_intellect
3:14.028 default O moonfire Fluffy_Pillow 38.0/100: 38% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(14), battle_potion_of_intellect
3:14.915 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(14), battle_potion_of_intellect
3:15.801 default R solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(13), battle_potion_of_intellect
3:16.557 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(12), battle_potion_of_intellect
3:17.660 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(11), battle_potion_of_intellect
3:18.415 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(10), battle_potion_of_intellect
3:19.637 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(9), battle_potion_of_intellect
3:20.601 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(8), battle_potion_of_intellect
3:21.425 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(7), battle_potion_of_intellect
3:22.662 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(6), battle_potion_of_intellect
3:23.635 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(5), battle_potion_of_intellect
3:24.615 default L sunfire Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(4), battle_potion_of_intellect
3:25.598 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(3), battle_potion_of_intellect
3:27.042 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power, battle_potion_of_intellect
3:28.495 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:29.469 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(7), solar_empowerment, battle_potion_of_intellect
3:30.717 default Q lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, battle_potion_of_intellect
3:32.262 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord
3:33.291 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord
3:34.836 default P stellar_flare Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(8), solar_empowerment, starlord
3:36.049 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(8), solar_empowerment, starlord
3:37.261 default O moonfire Fluffy_Pillow 19.5/100: 20% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(24)
3:38.200 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(23)
3:39.001 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(22)
3:40.206 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power celestial_alignment, solar_empowerment, starlord(2), overwhelming_power(25)
3:41.142 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24)
3:41.919 default L sunfire Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24), conch_of_dark_whispers
3:42.834 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(23), conch_of_dark_whispers
3:44.174 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), conch_of_dark_whispers
3:45.529 default R solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar, solar_empowerment(3), starlord(3), overwhelming_power(20), conch_of_dark_whispers
3:46.433 default R solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(19), conch_of_dark_whispers
3:47.343 default Q lunar_strike Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(18), conch_of_dark_whispers
3:48.711 default R solar_wrath Fluffy_Pillow 85.0/100: 85% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(17), conch_of_dark_whispers
3:49.626 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power arcanic_pulsar, overwhelming_power(16), conch_of_dark_whispers
3:50.804 default K starsurge Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(15), conch_of_dark_whispers
3:51.951 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(14), conch_of_dark_whispers
3:53.376 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(12), conch_of_dark_whispers
3:54.812 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(11), conch_of_dark_whispers
3:55.946 default N sunfire Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(10), conch_of_dark_whispers
3:57.052 default R solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(8)
3:57.998 default O moonfire Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(8)
3:59.110 default P stellar_flare Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(6)
4:00.230 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(5)
4:01.661 default H purifying_blast Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(4)
4:02.789 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(3)
4:03.753 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(2)
4:04.891 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power
4:05.862 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
4:07.321 default G use_items Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
4:07.321 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse
4:08.257 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse
4:09.192 default R solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse
4:10.291 default K starsurge Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(5), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse
4:11.488 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(2)
4:12.912 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(6), solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(2)
4:13.863 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(6), lunar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(2)
4:14.979 default N sunfire Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(2)
4:16.065 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(3)
4:17.397 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(3)
4:18.728 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(3)
4:19.617 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(4)
4:20.624 default Q lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
4:21.872 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), ignition_mages_fuse(4)
4:22.706 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(4)
4:23.953 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), ignition_mages_fuse(5)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="purification protocol"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/thorns
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

ripple in space : 36224 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
36224.1 36224.1 25.4 / 0.070% 4358.7 / 12.0% 4482.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 7.9 Astral Power 0.00% 57.9 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
ripple in space 36224
Heed My Call 292 (417) 0.8% (1.2%) 8.1 33.30sec 15342 0 Direct 8.1 9109 18215 10733 17.8%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.15 8.15 0.00 0.00 0.0000 0.0000 87461.19 87461.19 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.70 82.16% 9108.84 8901 9791 9106.43 0 9791 60985 60985 0.00
crit 1.45 17.84% 18215.35 17802 19582 14157.10 0 19582 26477 26477 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 125 0.3% 8.1 33.30sec 4609 0 Direct 8.1 3904 7803 4609 18.1%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.15 8.15 0.00 0.00 0.0000 0.0000 37554.84 37554.84 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.68 81.93% 3904.15 3815 4196 3904.57 3815 4196 26065 26065 0.00
crit 1.47 18.07% 7803.30 7629 8392 6055.61 0 8392 11490 11490 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5173 14.3% 76.1 3.84sec 20383 15571 Direct 76.1 17276 34541 20383 18.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.05 76.05 0.00 0.00 1.3090 0.0000 1550132.55 1550132.55 0.00 15571.40 15571.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.37 82.01% 17276.34 8882 22539 17283.32 16550 18215 1077449 1077449 0.00
crit 13.68 17.99% 34540.78 17765 45078 34553.77 30512 39821 472683 472683 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2545 7.0% 14.1 21.31sec 54135 52967 Direct 14.1 2981 5953 3508 17.7%  
Periodic 220.8 2738 5469 3229 18.0% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.08 14.08 220.80 220.80 1.0221 1.3440 762243.07 762243.07 0.00 2449.85 52966.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.58 82.26% 2981.33 2589 3780 2983.27 2709 3274 34532 34532 0.00
crit 2.50 17.74% 5953.20 5177 7561 5550.42 0 7561 14869 14869 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.1 82.03% 2737.84 3 3520 2739.07 2663 2869 495908 495908 0.00
crit 39.7 17.97% 5468.93 19 7039 5471.43 5055 5960 216935 216935 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Ripple in Space 348 1.0% 5.5 60.36sec 18991 16562 Direct 5.4 19114 0 19114 0.0%  

Stats details: ripple_in_space

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.47 5.44 0.00 0.00 1.1467 0.0000 103962.04 103962.04 0.00 16562.38 16562.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.44 100.00% 19114.37 18744 20618 19113.07 18744 20306 103962 103962 0.00
 
 

Action details: ripple_in_space

Static Values
  • id:302731
  • school:fire
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:302731
  • name:Ripple in Space
  • school:physical
  • tooltip:About to relocate with Ripple in Space.
  • description:Create an Azerite beacon at a target location. After {$d=4 seconds}, the Heart of Azeroth will relocate you to this beacon and deal {$s2=4952} Fire damage to all nearby enemies.$?a302780[ For {$302864d=10 seconds} after being relocated, you take {$302864s1=10}% reduced damage.][]
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17069.54
  • base_dd_max:17069.54
  • base_dd_mult:1.00
 
Shooting Stars 823 2.3% 44.0 6.63sec 5605 0 Direct 44.0 4750 9499 5605 18.0%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.01 44.01 0.00 0.00 0.0000 0.0000 246652.24 246652.24 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.08 81.99% 4749.64 4180 6104 4751.70 4442 5243 171380 171380 0.00
crit 7.92 18.01% 9498.66 8360 12209 9499.03 0 11740 75273 75273 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2883 (4566) 8.0% (12.6%) 91.4 3.22sec 14958 16596 Direct 92.0 7962 15920 9390 17.9%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.43 91.96 0.00 0.00 0.9013 0.0000 863571.78 863571.78 0.00 16596.34 16596.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.46 82.05% 7962.32 6967 10174 7967.13 7615 8356 600843 600843 0.00
crit 16.50 17.95% 15920.10 13933 20348 15930.21 14446 18065 262729 262729 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1683 4.7% 73.3 3.99sec 6873 0 Direct 73.3 6873 0 6873 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.35 73.35 0.00 0.00 0.0000 0.0000 504099.54 504099.54 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.35 100.00% 6872.86 5086 14854 6876.88 5967 7987 504100 504100 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5085.61
  • base_dd_max:5085.61
  • base_dd_mult:1.00
 
Starsurge 12122 33.5% 60.5 4.99sec 60047 57131 Direct 60.3 51095 102092 60245 17.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.46 60.26 0.00 0.00 1.0510 0.0000 3630238.12 3630238.12 0.00 57131.32 57131.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.45 82.06% 51095.33 45067 65034 51118.60 49083 53909 2526585 2526585 0.00
crit 10.81 17.94% 102092.05 90135 130068 102133.36 0 117178 1103653 1103653 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1651 4.6% 12.7 23.57sec 38807 37363 Direct 12.7 2492 4981 2940 18.0%  
Periodic 218.4 1774 3544 2092 18.0% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.74 12.74 218.45 218.45 1.0387 1.3467 494456.44 494456.44 0.00 1608.37 37362.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.45 82.01% 2491.64 2231 3259 2492.31 2312 2726 26035 26035 0.00
crit 2.29 17.99% 4980.74 4463 6518 4552.14 0 6518 11418 11418 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 179.2 82.03% 1773.93 1 2281 1774.73 1718 1854 317882 317882 0.00
crit 39.3 17.97% 3544.44 20 4562 3546.01 3336 3928 139122 139122 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5746 15.8% 88.7 3.12sec 19288 0 Direct 88.7 16355 32723 19288 17.9%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.73 88.73 0.00 0.00 0.0000 0.0000 1711490.86 1711490.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.83 82.08% 16354.75 15985 17583 16354.25 15985 17194 1191156 1191156 0.00
crit 15.90 17.92% 32722.72 31970 35167 32721.45 31970 34967 520334 520334 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2834 7.8% 18.0 16.59sec 47269 46050 Direct 18.0 4081 8164 4809 17.8%  
Periodic 220.0 2940 5876 3466 17.9% 98.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.96 17.96 219.97 219.97 1.0265 1.3450 848843.54 848843.54 0.00 2700.81 46050.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.76 82.17% 4080.58 3570 5214 4081.25 3779 4423 60212 60212 0.00
crit 3.20 17.83% 8164.25 7141 10429 7889.79 0 10429 26141 26141 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.5 82.07% 2939.87 2 3780 2941.19 2855 3064 530696 530696 0.00
crit 39.4 17.93% 5875.74 15 7561 5878.14 5412 6494 231794 231794 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
ripple in space
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ripple in space
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.47sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.10sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9042 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ripple in space
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ripple in space
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.1 53.1 44.7sec 5.0sec 92.82% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.32%
  • arcanic_pulsar_2:10.29%
  • arcanic_pulsar_3:11.28%
  • arcanic_pulsar_4:10.64%
  • arcanic_pulsar_5:13.75%
  • arcanic_pulsar_6:10.37%
  • arcanic_pulsar_7:10.85%
  • arcanic_pulsar_8:14.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 189.1sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.5sec 182.5sec 8.11% 7.79% 0.0(0.0) 2.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.7sec 37.7sec 25.76% 32.51% 0.0(0.0) 8.1

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.0sec 45.6sec 23.60% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.17% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.94%
  • ignition_mages_fuse_2:3.88%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 33.6 45.4 9.0sec 3.8sec 81.86% 99.69% 1.9(1.9) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.22%
  • lunar_empowerment_2:31.54%
  • lunar_empowerment_3:14.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.6 3.5 64.2sec 33.9sec 47.85% 0.00% 3.5(48.5) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.66%
  • overwhelming_power_9:1.71%
  • overwhelming_power_10:1.76%
  • overwhelming_power_11:1.81%
  • overwhelming_power_12:1.86%
  • overwhelming_power_13:1.91%
  • overwhelming_power_14:1.97%
  • overwhelming_power_15:2.03%
  • overwhelming_power_16:2.09%
  • overwhelming_power_17:2.16%
  • overwhelming_power_18:2.22%
  • overwhelming_power_19:2.29%
  • overwhelming_power_20:2.36%
  • overwhelming_power_21:2.44%
  • overwhelming_power_22:2.51%
  • overwhelming_power_23:2.59%
  • overwhelming_power_24:2.66%
  • overwhelming_power_25:1.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Reality Shift 9.7 0.0 32.2sec 32.2sec 63.00% 0.00% 188.6(188.6) 9.1

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_reality_shift
  • max_stacks:1
  • duration:20.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Buff details

  • stat:intellect
  • amount:668.07

Stack Uptimes

  • reality_shift_1:63.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:302916
  • name:Reality Shift
  • tooltip:
  • description:$?a302961[Your movement speed is increased by {$302961s1=5}%, and when][When] you move more than {$s1=25} yds within {$s4=4} sec, gain {$s2=194} $?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] for {$302952d=15 seconds}. This can only occur once every {$302953d=30 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Solar Empowerment 24.3 51.4 12.1sec 4.0sec 85.71% 79.87% 0.3(0.3) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.04%
  • solar_empowerment_2:39.71%
  • solar_empowerment_3:17.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.3 20.3sec 5.0sec 97.03% 92.06% 15.4(15.4) 11.5

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.91%
  • starlord_2:22.47%
  • starlord_3:59.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.9sec 45.4sec 23.64% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.64%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
ripple in space
starsurge Astral Power 60.5 2418.3 40.0 40.0 1501.2
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 92.43 739.41 (31.06%) 8.00 0.06 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.36%) 40.00 0.00 0.00%
sunfire Astral Power 17.96 53.87 (2.26%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.01 176.03 (7.39%) 4.00 0.01 0.01%
moonfire Astral Power 14.08 42.24 (1.77%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.74 101.93 (4.28%) 8.00 0.00 0.00%
lunar_strike Astral Power 76.05 912.55 (38.33%) 12.00 0.06 0.01%
natures_balance Astral Power 400.43 200.21 (8.41%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.20 74.38 (3.12%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.94 8.06
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.78 0.00 78.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data ripple in space Fight Length
Count 7600
Mean 299.94
Minimum 240.00
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data ripple in space Damage Per Second
Count 7600
Mean 36224.06
Minimum 32739.94
Maximum 40643.08
Spread ( max - min ) 7903.14
Range [ ( max - min ) / 2 * 100% ] 10.91%
Standard Deviation 1130.6666
5th Percentile 34444.74
95th Percentile 38135.02
( 95th Percentile - 5th Percentile ) 3690.28
Mean Distribution
Standard Deviation 12.9696
95.00% Confidence Intervall ( 36198.64 - 36249.48 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3743
0.1 Scale Factor Error with Delta=300 10914
0.05 Scale Factor Error with Delta=300 43653
0.01 Scale Factor Error with Delta=300 1091322
Priority Target DPS
Sample Data ripple in space Priority Target Damage Per Second
Count 7600
Mean 36224.06
Minimum 32739.94
Maximum 40643.08
Spread ( max - min ) 7903.14
Range [ ( max - min ) / 2 * 100% ] 10.91%
Standard Deviation 1130.6666
5th Percentile 34444.74
95th Percentile 38135.02
( 95th Percentile - 5th Percentile ) 3690.28
Mean Distribution
Standard Deviation 12.9696
95.00% Confidence Intervall ( 36198.64 - 36249.48 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3743
0.1 Scale Factor Error with Delta=300 10914
0.05 Scale Factor Error with Delta=300 43653
0.01 Scale Factor Error with Delta=300 1091322
DPS(e)
Sample Data ripple in space Damage Per Second (Effective)
Count 7600
Mean 36224.06
Minimum 32739.94
Maximum 40643.08
Spread ( max - min ) 7903.14
Range [ ( max - min ) / 2 * 100% ] 10.91%
Damage
Sample Data ripple in space Damage
Count 7600
Mean 10840706.20
Minimum 8411963.12
Maximum 13265967.45
Spread ( max - min ) 4854004.33
Range [ ( max - min ) / 2 * 100% ] 22.39%
DTPS
Sample Data ripple in space Damage Taken Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data ripple in space Healing Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data ripple in space Healing Per Second (Effective)
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data ripple in space Heal
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data ripple in space Healing Taken Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data ripple in space Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data ripple in spaceTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data ripple in space Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.94 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
H 5.47 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 thorns
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.77 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 60.46 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.07 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.75 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.51 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.33 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.74 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 76.41 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 91.69 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.38 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRKRQRKRQRQKRQNRORQRSKPRQKQKQQQRRKRKRQKRQLOQQKQKPQRKQRQRKNQHORKRQRRKPQRRKNRQRQMRKKQQRRKNPQRKQRRQRKOQRKNQRRKQPQHRQRKGKORQKRQNQKRQRRRRPRRRKKNOQKRQQRKRQQRRRNKKPQORQKRQRKRHQNIEFRKRQPRKORQKRQKRQKRQLQKRQQRKOPQRKNRQRQLRKKQQRQKQOPKRHQNQGRKQRKQRRRKQRRRKQR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask ripple in space 58.0/100: 58% astral_power
Pre precombat 1 food ripple in space 58.0/100: 58% astral_power
Pre precombat 2 augmentation ripple in space 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H ripple_in_space Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.248 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, battle_potion_of_intellect
0:02.209 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, reality_shift, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.141 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, reality_shift, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.072 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, reality_shift, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.005 default I celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.816 default F berserking Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.816 default G use_items Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.816 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:06.569 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.322 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.077 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.832 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.685 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(25), battle_potion_of_intellect, ignition_mages_fuse
0:10.438 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.193 default R solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.947 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.705 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.458 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.221 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.977 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.731 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.486 default N sunfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.240 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.994 default O moonfire Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.747 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(16), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.501 default Q lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(15), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.299 default R solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(14), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.054 default S sunfire Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(13), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.808 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), overwhelming_power(13), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.564 default P stellar_flare Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, overwhelming_power(12), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.317 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, overwhelming_power(11), ignition_mages_fuse(5)
0:24.071 default Q lunar_strike Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord, overwhelming_power(10), ignition_mages_fuse(5)
0:24.898 default K starsurge Fluffy_Pillow 81.5/100: 82% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(10), ignition_mages_fuse(5)
0:25.652 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(9), ignition_mages_fuse(5)
0:26.579 default K starsurge Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(8)
0:27.459 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(7)
0:28.553 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(6)
0:29.651 default Q lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(5)
0:30.754 default R solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(4)
0:31.509 default R solar_wrath Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(3)
0:32.263 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(2)
0:33.138 default R solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power
0:33.892 default K starsurge Fluffy_Pillow 71.5/100: 72% astral_power bloodlust, reality_shift, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power
0:34.655 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3)
0:35.407 default Q lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3)
0:36.385 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3)
0:37.152 default R solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3)
0:37.906 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3)
0:38.884 default L sunfire Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3)
0:39.651 default O moonfire Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, reality_shift, arcanic_pulsar(2), lunar_empowerment(2), starlord(3)
0:40.532 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, reality_shift, arcanic_pulsar(2), lunar_empowerment(2), starlord(3)
0:41.656 default Q lunar_strike Fluffy_Pillow 58.5/100: 59% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment, starlord(3), torrent_of_elements
0:43.116 default K starsurge Fluffy_Pillow 75.5/100: 76% astral_power reality_shift, arcanic_pulsar(2), torrent_of_elements
0:44.366 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
0:45.911 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power reality_shift, arcanic_pulsar(3), solar_empowerment, starlord, torrent_of_elements
0:47.122 default P stellar_flare Fluffy_Pillow 10.0/100: 10% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
0:48.300 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
0:49.800 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power reality_shift, arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
0:50.802 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power reality_shift, arcanic_pulsar(4), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers
0:51.980 default Q lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
0:53.439 default R solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
0:54.413 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
0:55.870 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
0:56.844 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
0:57.990 default N sunfire Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
0:59.137 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:00.598 default H ripple_in_space Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), conch_of_dark_whispers
1:01.744 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), conch_of_dark_whispers
1:02.891 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), conch_of_dark_whispers
1:03.864 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(6), solar_empowerment(2), conch_of_dark_whispers
1:05.112 default R solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord, conch_of_dark_whispers
1:06.142 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, conch_of_dark_whispers
1:07.687 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment(3), starlord, conch_of_dark_whispers
1:08.718 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment(2), starlord, conch_of_dark_whispers
1:09.749 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment, starlord, conch_of_dark_whispers
1:10.963 default P stellar_flare Fluffy_Pillow 4.0/100: 4% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:12.142 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:13.642 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment(3), starlord(2)
1:14.643 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment(2), starlord(2)
1:15.645 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment, starlord(2)
1:16.823 default N sunfire Fluffy_Pillow 20.0/100: 20% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3)
1:17.820 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3)
1:18.668 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3)
1:19.937 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power reality_shift, celestial_alignment, solar_empowerment, starlord(3)
1:20.784 default Q lunar_strike Fluffy_Pillow 53.5/100: 54% astral_power reality_shift, celestial_alignment, starlord(3)
1:22.279 default M moonfire Fluffy_Pillow 66.5/100: 67% astral_power reality_shift, celestial_alignment, starlord(3)
1:23.275 default R solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power reality_shift, starlord(3)
1:24.419 default K starsurge Fluffy_Pillow 79.0/100: 79% astral_power reality_shift
1:25.669 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord
1:26.883 default Q lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:28.383 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2)
1:29.885 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(2), solar_empowerment(3), starlord(2)
1:30.886 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(2)
1:31.887 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(2), solar_empowerment, starlord(2)
1:33.064 default N sunfire Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
1:34.209 default P stellar_flare Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
1:35.353 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
1:36.813 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3)
1:37.787 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3)
1:38.934 default Q lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3)
1:40.394 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3)
1:41.368 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3)
1:42.343 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(4), lunar_empowerment, starlord(3)
1:43.802 default R solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(4), starlord(3)
1:44.947 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power reality_shift, arcanic_pulsar(4)
1:46.196 default O moonfire Fluffy_Pillow 16.5/100: 17% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord
1:47.408 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord
1:48.952 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power reality_shift, arcanic_pulsar(5), solar_empowerment, starlord, conch_of_dark_whispers
1:49.982 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power reality_shift, arcanic_pulsar(5), starlord, conch_of_dark_whispers
1:51.196 default N sunfire Fluffy_Pillow 7.0/100: 7% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), conch_of_dark_whispers
1:52.373 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), conch_of_dark_whispers
1:53.873 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power reality_shift, arcanic_pulsar(6), solar_empowerment, starlord(2), conch_of_dark_whispers
1:54.876 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power reality_shift, arcanic_pulsar(6), starlord(2), conch_of_dark_whispers
1:56.055 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, starlord(2), conch_of_dark_whispers
1:57.232 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24), conch_of_dark_whispers
1:58.569 default P stellar_flare Fluffy_Pillow 23.0/100: 23% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(23), conch_of_dark_whispers
1:59.624 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(22), conch_of_dark_whispers
2:00.972 default H ripple_in_space Fluffy_Pillow 44.5/100: 45% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(21), conch_of_dark_whispers
2:02.034 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(19), conch_of_dark_whispers
2:02.943 default Q lunar_strike Fluffy_Pillow 53.5/100: 54% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, starlord(3), overwhelming_power(19)
2:04.305 default R solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(17), conch_of_dark_whispers
2:05.382 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar(7), overwhelming_power(16), conch_of_dark_whispers
2:06.560 default G use_items Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(15), conch_of_dark_whispers
2:06.560 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(15), conch_of_dark_whispers, ignition_mages_fuse
2:07.663 default O moonfire Fluffy_Pillow 17.0/100: 17% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(14), conch_of_dark_whispers, ignition_mages_fuse
2:08.599 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(13), conch_of_dark_whispers, ignition_mages_fuse
2:09.398 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(12), conch_of_dark_whispers, ignition_mages_fuse
2:10.597 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(11), conch_of_dark_whispers, ignition_mages_fuse(2)
2:11.508 default R solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(10), conch_of_dark_whispers, ignition_mages_fuse(2)
2:12.263 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(9), conch_of_dark_whispers, ignition_mages_fuse(2)
2:13.399 default N sunfire Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(8), conch_of_dark_whispers, ignition_mages_fuse(2)
2:14.426 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(7), conch_of_dark_whispers, ignition_mages_fuse(2)
2:15.739 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(24), conch_of_dark_whispers, ignition_mages_fuse(3)
2:16.681 default R solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(23), conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.484 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), conch_of_dark_whispers, ignition_mages_fuse(3)
2:18.689 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power reality_shift, arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(21), conch_of_dark_whispers, ignition_mages_fuse(4)
2:19.471 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power reality_shift, arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(20), conch_of_dark_whispers, ignition_mages_fuse(4)
2:20.253 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power reality_shift, arcanic_pulsar(2), starlord(3), overwhelming_power(19), conch_of_dark_whispers, ignition_mages_fuse(4)
2:21.177 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power reality_shift, arcanic_pulsar(2), starlord(3), overwhelming_power(18), conch_of_dark_whispers, ignition_mages_fuse(4)
2:22.104 default P stellar_flare Fluffy_Pillow 56.5/100: 56% astral_power reality_shift, arcanic_pulsar(2), starlord(3), overwhelming_power(17), conch_of_dark_whispers, ignition_mages_fuse(4)
2:23.033 default R solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power reality_shift, arcanic_pulsar(2), starlord(3), overwhelming_power(16), conch_of_dark_whispers, ignition_mages_fuse(5)
2:23.934 default R solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power reality_shift, arcanic_pulsar(2), starlord(3), overwhelming_power(16), conch_of_dark_whispers, ignition_mages_fuse(5)
2:24.836 default R solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power reality_shift, arcanic_pulsar(2), starlord(3), overwhelming_power(15), conch_of_dark_whispers, ignition_mages_fuse(5)
2:25.740 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power reality_shift, arcanic_pulsar(2), overwhelming_power(14), conch_of_dark_whispers, ignition_mages_fuse(5)
2:26.729 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(13), conch_of_dark_whispers
2:27.886 default N sunfire Fluffy_Pillow 16.5/100: 17% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(12), conch_of_dark_whispers
2:29.013 default O moonfire Fluffy_Pillow 24.0/100: 24% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(10), conch_of_dark_whispers
2:30.147 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(9)
2:31.597 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(8)
2:32.739 default R solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(7)
2:33.688 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(6)
2:35.113 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(4)
2:36.551 default R solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power reality_shift, arcanic_pulsar(5), solar_empowerment(3), starlord(3), overwhelming_power(3)
2:37.514 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(2)
2:38.654 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power
2:39.623 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3)
2:41.083 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
2:42.542 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3)
2:43.516 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3)
2:44.491 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3)
2:45.464 default N sunfire Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(6), starlord(3)
2:46.610 default K starsurge Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(6)
2:47.859 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord
2:49.071 default P stellar_flare Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2)
2:50.250 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2)
2:51.751 default O moonfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(2)
2:52.930 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(2)
2:53.931 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2)
2:55.432 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2)
2:56.611 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power reality_shift, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3)
2:57.460 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power reality_shift, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
2:58.730 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3)
2:59.577 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3)
3:00.573 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3)
3:01.420 default H ripple_in_space Fluffy_Pillow 22.5/100: 23% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:02.416 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power reality_shift, arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:03.877 default N sunfire Fluffy_Pillow 36.5/100: 37% astral_power reality_shift, arcanic_pulsar, lunar_empowerment, solar_empowerment(3), starlord(3)
3:05.022 default I celestial_alignment Fluffy_Pillow 40.0/100: 40% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3)
3:06.019 default E potion Fluffy_Pillow 81.0/100: 81% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3)
3:06.019 default F berserking Fluffy_Pillow 81.0/100: 81% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), battle_potion_of_intellect
3:06.019 default R solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power berserking, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), battle_potion_of_intellect
3:06.789 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power berserking, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), conch_of_dark_whispers, battle_potion_of_intellect
3:07.776 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power berserking, reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord, conch_of_dark_whispers, battle_potion_of_intellect
3:08.590 default Q lunar_strike Fluffy_Pillow 58.5/100: 59% astral_power berserking, reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord, conch_of_dark_whispers, battle_potion_of_intellect
3:09.813 default P stellar_flare Fluffy_Pillow 71.5/100: 72% astral_power berserking, reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, conch_of_dark_whispers, battle_potion_of_intellect
3:10.772 default R solar_wrath Fluffy_Pillow 80.0/100: 80% astral_power berserking, reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, conch_of_dark_whispers, battle_potion_of_intellect
3:11.588 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power berserking, reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, conch_of_dark_whispers, battle_potion_of_intellect
3:12.548 default O moonfire Fluffy_Pillow 49.0/100: 49% astral_power berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:13.481 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:14.274 default Q lunar_strike Fluffy_Pillow 61.5/100: 62% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:15.460 default K starsurge Fluffy_Pillow 74.0/100: 74% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:16.392 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:17.163 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:18.319 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:19.316 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:20.164 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:21.434 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:22.430 default R solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:23.278 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect
3:24.545 default L sunfire Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:25.541 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:27.001 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), torrent_of_elements, battle_potion_of_intellect
3:28.249 default R solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord, torrent_of_elements, battle_potion_of_intellect
3:29.281 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:30.824 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:32.369 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers
3:33.399 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers
3:34.612 default O moonfire Fluffy_Pillow 10.0/100: 10% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
3:35.788 default P stellar_flare Fluffy_Pillow 17.5/100: 18% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
3:36.965 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
3:38.465 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
3:39.467 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers
3:40.645 default N sunfire Fluffy_Pillow 21.0/100: 21% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
3:41.642 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
3:42.488 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
3:43.759 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power reality_shift, celestial_alignment, solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
3:44.607 default Q lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power reality_shift, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
3:45.877 default L sunfire Fluffy_Pillow 67.5/100: 68% astral_power celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(25), conch_of_dark_whispers
3:46.788 default R solar_wrath Fluffy_Pillow 71.0/100: 71% astral_power solar_empowerment, starlord(3), overwhelming_power(24), conch_of_dark_whispers
3:47.681 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power overwhelming_power(23), conch_of_dark_whispers
3:48.828 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(22), conch_of_dark_whispers
3:49.946 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(21), conch_of_dark_whispers
3:51.337 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(19), conch_of_dark_whispers
3:52.737 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(2), overwhelming_power(18)
3:53.675 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(17)
3:55.083 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(2), solar_empowerment, starlord(2), overwhelming_power(15)
3:56.197 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14)
3:57.584 default O moonfire Fluffy_Pillow 30.0/100: 30% astral_power reality_shift, arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(13)
3:58.677 default P stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power reality_shift, arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(12)
3:59.773 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power reality_shift, arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(11)
4:00.873 default R solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(10)
4:01.813 default H ripple_in_space Fluffy_Pillow 16.0/100: 16% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(9)
4:02.920 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(8)
4:04.337 default N sunfire Fluffy_Pillow 33.5/100: 34% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(6)
4:05.456 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(5)
4:06.888 default G use_items Fluffy_Pillow 50.5/100: 51% astral_power reality_shift, arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(4)
4:06.888 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power reality_shift, arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(4), ignition_mages_fuse
4:07.809 default K starsurge Fluffy_Pillow 59.0/100: 59% astral_power reality_shift, arcanic_pulsar(4), solar_empowerment, overwhelming_power(3), conch_of_dark_whispers, ignition_mages_fuse
4:08.992 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(2), conch_of_dark_whispers, ignition_mages_fuse
4:10.462 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power reality_shift, arcanic_pulsar(5), solar_empowerment(2), starlord, conch_of_dark_whispers, ignition_mages_fuse
4:11.452 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power reality_shift, arcanic_pulsar(5), solar_empowerment, starlord, conch_of_dark_whispers, ignition_mages_fuse(2)
4:12.568 default Q lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers, ignition_mages_fuse(2)
4:13.952 default R solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power reality_shift, arcanic_pulsar(6), solar_empowerment(3), starlord(2), conch_of_dark_whispers, ignition_mages_fuse(2)
4:14.876 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power reality_shift, arcanic_pulsar(6), solar_empowerment(2), starlord(2), conch_of_dark_whispers, ignition_mages_fuse(2)
4:15.799 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power reality_shift, arcanic_pulsar(6), solar_empowerment, starlord(2), conch_of_dark_whispers, ignition_mages_fuse(3)
4:16.687 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power reality_shift, arcanic_pulsar(6), starlord(2), conch_of_dark_whispers, ignition_mages_fuse(3)
4:17.734 default Q lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse(3)
4:19.027 default R solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
4:19.858 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(7), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
4:20.838 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(7), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
4:21.818 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(7), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
4:22.796 default Q lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), ignition_mages_fuse(4)
4:24.045 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), ignition_mages_fuse(5)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="ripple in space"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/thorns
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

unbound force : 36693 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
36692.6 36692.6 25.3 / 0.069% 4347.9 / 11.8% 4530.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 8.0 Astral Power 0.00% 58.0 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
unbound force 36693
Heed My Call 300 (429) 0.8% (1.2%) 8.1 33.63sec 15879 0 Direct 8.1 9109 18225 11112 22.0%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.10 8.10 0.00 0.00 0.0000 0.0000 90032.23 90032.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.32 78.03% 9109.43 8901 9791 9105.97 0 9791 57597 57597 0.00
crit 1.78 21.97% 18224.78 17802 19582 15307.35 0 19582 32436 32436 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 129 0.4% 8.1 33.63sec 4767 0 Direct 8.1 3904 7809 4768 22.1%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.10 8.10 0.00 0.00 0.0000 0.0000 38626.10 38626.10 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.31 77.90% 3904.30 3815 4196 3903.29 0 4196 24643 24643 0.00
crit 1.79 22.10% 7808.79 7629 8392 6575.16 0 8392 13983 13983 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5077 13.9% 76.2 3.84sec 19963 15236 Direct 76.2 16591 33092 19963 20.4%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.20 76.20 0.00 0.00 1.3102 0.0000 1521184.13 1521184.13 0.00 15236.37 15236.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.63 79.56% 16590.98 8882 21253 16598.35 15898 17457 1005854 1005854 0.00
crit 15.57 20.44% 33092.40 17765 42507 33105.42 29707 36818 515330 515330 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2516 6.9% 14.1 21.33sec 53610 52498 Direct 14.1 2857 5687 3473 21.8%  
Periodic 220.8 2631 5239 3192 21.5% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.06 14.06 220.85 220.85 1.0212 1.3436 753765.38 753765.38 0.00 2422.91 52497.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.00 78.24% 2857.04 2589 3565 2859.16 2621 3127 31429 31429 0.00
crit 3.06 21.76% 5686.75 5177 7129 5515.20 0 7129 17400 17400 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 173.3 78.48% 2630.69 2 3319 2632.00 2557 2772 455965 455965 0.00
crit 47.5 21.52% 5239.05 7 6638 5241.07 4901 5576 248971 248971 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 819 2.2% 44.1 6.63sec 5555 0 Direct 44.1 4564 9087 5555 21.9%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.12 44.12 0.00 0.00 0.0000 0.0000 245084.93 245084.93 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.45 78.09% 4564.48 4180 5756 4566.57 4238 5007 157246 157246 0.00
crit 9.67 21.91% 9087.23 8360 11513 9088.62 0 10888 87838 87838 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2833 (4483) 7.7% (12.2%) 91.8 3.20sec 14626 16206 Direct 92.4 7641 15247 9187 20.3%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.83 92.36 0.00 0.00 0.9025 0.0000 848554.06 848554.06 0.00 16205.99 16205.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.58 79.67% 7641.04 6967 9594 7645.79 7358 8054 562243 562243 0.00
crit 18.78 20.33% 15246.91 13933 19188 15256.69 14064 16868 286311 286311 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1651 4.5% 73.4 3.99sec 6735 0 Direct 73.4 6735 0 6735 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.43 73.43 0.00 0.00 0.0000 0.0000 494581.96 494581.96 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.43 100.00% 6735.26 5086 14007 6739.09 5900 7936 494582 494582 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5085.61
  • base_dd_max:5085.61
  • base_dd_mult:1.00
 
Starsurge 12006 32.7% 60.6 4.98sec 59329 56428 Direct 60.4 49277 98239 59523 20.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.59 60.40 0.00 0.00 1.0514 0.0000 3595018.77 3595018.77 0.00 56427.86 56427.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.76 79.08% 49276.89 45067 61614 49303.11 47373 52018 2353472 2353472 0.00
crit 12.64 20.92% 98238.80 90135 123227 98278.93 90135 112197 1241547 1241547 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1632 4.5% 12.7 23.57sec 38377 36997 Direct 12.7 2401 4792 2904 21.1%  
Periodic 218.5 1705 3396 2068 21.5% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.74 12.74 218.51 218.51 1.0374 1.3464 488994.71 488994.71 0.00 1590.66 36997.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.06 78.93% 2400.57 2231 3073 2401.54 2231 2616 24143 24143 0.00
crit 2.68 21.07% 4791.84 4463 6146 4547.23 0 6146 12864 12864 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 171.5 78.50% 1704.88 5 2151 1705.73 1659 1803 292429 292429 0.00
crit 47.0 21.50% 3395.69 10 4302 3397.06 3203 3719 159559 159559 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5815 15.8% 88.2 3.14sec 19635 0 Direct 88.2 16356 32714 19635 20.0%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.23 88.23 0.00 0.00 0.0000 0.0000 1732321.25 1732321.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.54 79.95% 16355.62 15985 17583 16355.59 15985 17284 1153743 1153743 0.00
crit 17.69 20.05% 32713.78 31970 35167 32717.82 31970 35167 578578 578578 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2803 7.6% 18.0 16.60sec 46723 45566 Direct 18.0 3918 7808 4762 21.7%  
Periodic 220.0 2825 5628 3427 21.5% 98.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.97 17.97 220.02 220.02 1.0255 1.3447 839553.57 839553.57 0.00 2671.37 45566.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.07 78.31% 3918.16 3570 4917 3919.26 3641 4333 55136 55136 0.00
crit 3.90 21.69% 7807.78 7141 9834 7709.65 0 9834 30425 30425 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 172.8 78.53% 2825.35 2 3565 2826.74 2749 2973 488157 488157 0.00
crit 47.2 21.47% 5627.64 11 7129 5629.76 5301 6081 265836 265836 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
The Unbound Force 1112 3.0% 5.0 67.13sec 67269 60477 Periodic 60.6 1322 6795 5507 76.5% 3.3%

Stats details: the_unbound_force

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.96 0.00 39.58 60.62 1.1125 0.2500 333771.74 333771.74 0.00 21655.21 60476.85
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.3 23.55% 1322.13 87 1575 1320.64 963 1536 18873 18873 0.00
crit 46.3 76.45% 6795.35 434 7875 6795.71 6199 7643 314898 314898 0.00
 
 

Action details: the_unbound_force

Static Values
  • id:298452
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.reckless_force.up|time<5
Spelldata
  • id:298452
  • name:The Unbound Force
  • school:fire
  • tooltip:
  • description:Unleash the forces within the Heart of Azeroth, causing shards of Azerite to strike your target for ${({$298407s3=378}*(({$d=2 seconds}/$t)+1)+{$298407s3=378})} Fire damage over {$d=2 seconds}. This damage is increased by {$s2=300}% if it critically strikes.$?a298456[ Each time The Unbound Force causes a critical strike, it immediately strikes the target with an additional Azerite shard, up to a maximum of $298456m2.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:0.33
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: the_unbound_force_tick

Static Values
  • id:298453
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:50.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:298453
  • name:The Unbound Force
  • school:fire
  • tooltip:
  • description:{$@spelldesc298452=Unleash the forces within the Heart of Azeroth, causing shards of Azerite to strike your target for ${({$298407s3=378}*(({$d=2 seconds}/$t)+1)+{$298407s3=378})} Fire damage over {$d=2 seconds}. This damage is increased by {$s2=300}% if it critically strikes.$?a298456[ Each time The Unbound Force causes a critical strike, it immediately strikes the target with an additional Azerite shard, up to a maximum of $298456m2.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1303.78
  • base_dd_max:1303.78
  • base_dd_mult:1.00
 
Simple Action Stats Execute Interval
unbound force
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unbound force
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.34sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.05sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9014 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unbound force
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unbound force
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.1 53.3 44.6sec 5.0sec 92.78% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.29%
  • arcanic_pulsar_2:10.41%
  • arcanic_pulsar_3:11.42%
  • arcanic_pulsar_4:10.53%
  • arcanic_pulsar_5:13.69%
  • arcanic_pulsar_6:10.24%
  • arcanic_pulsar_7:10.83%
  • arcanic_pulsar_8:14.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 189.1sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.4sec 182.4sec 8.11% 7.72% 0.0(0.0) 2.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.6sec 37.6sec 25.79% 32.43% 0.0(0.0) 8.1

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.6sec 45.1sec 23.82% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.17% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.94%
  • ignition_mages_fuse_2:3.88%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 33.3 45.9 9.1sec 3.8sec 82.22% 99.70% 1.9(1.9) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.75%
  • lunar_empowerment_2:32.01%
  • lunar_empowerment_3:14.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.5 3.4 64.4sec 33.9sec 47.75% 0.00% 3.4(48.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.66%
  • overwhelming_power_9:1.71%
  • overwhelming_power_10:1.76%
  • overwhelming_power_11:1.81%
  • overwhelming_power_12:1.87%
  • overwhelming_power_13:1.92%
  • overwhelming_power_14:1.97%
  • overwhelming_power_15:2.03%
  • overwhelming_power_16:2.09%
  • overwhelming_power_17:2.15%
  • overwhelming_power_18:2.21%
  • overwhelming_power_19:2.28%
  • overwhelming_power_20:2.35%
  • overwhelming_power_21:2.42%
  • overwhelming_power_22:2.50%
  • overwhelming_power_23:2.58%
  • overwhelming_power_24:2.65%
  • overwhelming_power_25:1.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Reckless Force 4.0 0.0 66.9sec 66.9sec 5.29% 0.00% 0.0(0.0) 3.9

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_reckless_force
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.70
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • reckless_force_1:5.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:302932
  • name:Reckless Force
  • tooltip:Critical Strike increased by {$s1=50}%.
  • description:{$@spelldesc298407=When an ability fails to critically strike, you have a high chance to gain Reckless Force. When Reckless Force reaches {$302917u=20} stacks, your critical strike is increased by {$302932s1=50}% for {$302932d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Reckless Force (_counter) 4.9 84.2 66.8sec 3.3sec 91.53% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_reckless_force_counter
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • reckless_force_counter_1:5.57%
  • reckless_force_counter_2:5.23%
  • reckless_force_counter_3:5.16%
  • reckless_force_counter_4:5.13%
  • reckless_force_counter_5:5.03%
  • reckless_force_counter_6:4.99%
  • reckless_force_counter_7:5.00%
  • reckless_force_counter_8:4.86%
  • reckless_force_counter_9:4.85%
  • reckless_force_counter_10:4.81%
  • reckless_force_counter_11:4.76%
  • reckless_force_counter_12:4.68%
  • reckless_force_counter_13:4.65%
  • reckless_force_counter_14:4.61%
  • reckless_force_counter_15:4.57%
  • reckless_force_counter_16:4.48%
  • reckless_force_counter_17:4.45%
  • reckless_force_counter_18:4.37%
  • reckless_force_counter_19:4.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:302917
  • name:Reckless Force
  • tooltip:Upon reaching {$u=20} stacks, you gain $302932s~1% Critical Strike for {$302932d=3 seconds}.
  • description:{$@spelldesc298407=When an ability fails to critically strike, you have a high chance to gain Reckless Force. When Reckless Force reaches {$302917u=20} stacks, your critical strike is increased by {$302932s1=50}% for {$302932d=3 seconds}.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Solar Empowerment 24.3 51.5 12.1sec 4.0sec 85.78% 79.63% 0.3(0.3) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:27.85%
  • solar_empowerment_2:40.01%
  • solar_empowerment_3:17.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.4 20.3sec 5.0sec 97.29% 92.20% 15.4(15.4) 11.4

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.49%
  • starlord_2:22.82%
  • starlord_3:59.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.7sec 45.2sec 23.82% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.82%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
unbound force
starsurge Astral Power 60.6 2423.8 40.0 40.0 1483.2
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 92.83 742.59 (31.12%) 8.00 0.06 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.35%) 40.00 0.00 0.00%
sunfire Astral Power 17.97 53.91 (2.26%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.12 176.46 (7.40%) 4.00 0.01 0.01%
moonfire Astral Power 14.06 42.18 (1.77%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.74 101.93 (4.27%) 8.00 0.00 0.00%
lunar_strike Astral Power 76.20 914.34 (38.32%) 12.00 0.06 0.01%
natures_balance Astral Power 400.43 200.21 (8.39%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.21 74.57 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.96 8.08
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.03 0.00 75.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data unbound force Fight Length
Count 7600
Mean 299.94
Minimum 240.00
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data unbound force Damage Per Second
Count 7600
Mean 36692.63
Minimum 33120.22
Maximum 40535.26
Spread ( max - min ) 7415.03
Range [ ( max - min ) / 2 * 100% ] 10.10%
Standard Deviation 1127.5378
5th Percentile 34902.49
95th Percentile 38611.55
( 95th Percentile - 5th Percentile ) 3709.06
Mean Distribution
Standard Deviation 12.9337
95.00% Confidence Intervall ( 36667.28 - 36717.98 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3628
0.1 Scale Factor Error with Delta=300 10853
0.05 Scale Factor Error with Delta=300 43412
0.01 Scale Factor Error with Delta=300 1085291
Priority Target DPS
Sample Data unbound force Priority Target Damage Per Second
Count 7600
Mean 36692.63
Minimum 33120.22
Maximum 40535.26
Spread ( max - min ) 7415.03
Range [ ( max - min ) / 2 * 100% ] 10.10%
Standard Deviation 1127.5378
5th Percentile 34902.49
95th Percentile 38611.55
( 95th Percentile - 5th Percentile ) 3709.06
Mean Distribution
Standard Deviation 12.9337
95.00% Confidence Intervall ( 36667.28 - 36717.98 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3628
0.1 Scale Factor Error with Delta=300 10853
0.05 Scale Factor Error with Delta=300 43412
0.01 Scale Factor Error with Delta=300 1085291
DPS(e)
Sample Data unbound force Damage Per Second (Effective)
Count 7600
Mean 36692.63
Minimum 33120.22
Maximum 40535.26
Spread ( max - min ) 7415.03
Range [ ( max - min ) / 2 * 100% ] 10.10%
Damage
Sample Data unbound force Damage
Count 7600
Mean 10981488.82
Minimum 8633945.19
Maximum 13484220.03
Spread ( max - min ) 4850274.84
Range [ ( max - min ) / 2 * 100% ] 22.08%
DTPS
Sample Data unbound force Damage Taken Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data unbound force Healing Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data unbound force Healing Per Second (Effective)
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data unbound force Heal
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data unbound force Healing Taken Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data unbound force Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data unbound forceTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data unbound force Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.94 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 thorns
H 4.96 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.87 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 60.60 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.09 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.75 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.52 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.31 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.74 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 76.58 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 92.08 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.37 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRQRKRQKRQKRQNRQORQRKPKRLQKQQRQRRRQKRKRQRQRMQKNQPKRQQKRQKRQNQORKRKRQPQKHRQRNQRKRQJKRKMQQKRPQKNRQRRRRKKOQQRKQNRRKPQQRQRGKRKRQHKNOQQKRQRPRRRRKKQNOQKRQQKRQQRRPKNQKRQKRQHORKQRRRIEFKNKPRQKRORQRKRQRQRQLRKKQQRPKRQKRQMNQRRRKQKQRRRKOPNQHRQGRRKKQQRRKQRQKQRR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask unbound force 58.0/100: 58% astral_power
Pre precombat 1 food unbound force 58.0/100: 58% astral_power
Pre precombat 2 augmentation unbound force 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H the_unbound_force Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.250 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, battle_potion_of_intellect
0:02.211 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.146 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.081 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.016 default I celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, reckless_force_counter, battle_potion_of_intellect
0:05.828 default F berserking Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, reckless_force_counter, battle_potion_of_intellect
0:05.828 default G use_items Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, reckless_force_counter, battle_potion_of_intellect
0:05.828 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, reckless_force_counter, battle_potion_of_intellect, ignition_mages_fuse
0:06.583 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter, battle_potion_of_intellect, ignition_mages_fuse
0:07.337 default Q lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), reckless_force_counter, battle_potion_of_intellect, ignition_mages_fuse
0:08.213 default R solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter, battle_potion_of_intellect, ignition_mages_fuse
0:08.968 default K starsurge Fluffy_Pillow 77.5/100: 78% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), reckless_force_counter, battle_potion_of_intellect, ignition_mages_fuse
0:09.723 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter, battle_potion_of_intellect, ignition_mages_fuse
0:10.477 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), reckless_force_counter, battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.296 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.050 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.804 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), reckless_force_counter(2), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.622 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(2), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.377 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter(2), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.132 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), reckless_force_counter(2), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.919 default N sunfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(2), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.673 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(2), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.427 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), reckless_force_counter(2), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.216 default O moonfire Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(24), reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.971 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(24), reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.726 default Q lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(23), reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.504 default R solar_wrath Fluffy_Pillow 79.5/100: 80% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(22), reckless_force_counter(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.259 default K starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, overwhelming_power(21), reckless_force_counter(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.013 default P stellar_flare Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(20), reckless_force_counter(4), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.767 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(20), reckless_force_counter(4), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.522 default R solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(19), reckless_force_counter(4), ignition_mages_fuse(5)
0:24.278 default L sunfire Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(18), reckless_force_counter(4), ignition_mages_fuse(5)
0:25.033 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(17), reckless_force_counter(4), ignition_mages_fuse(5)
0:25.936 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(17), reckless_force_counter(5)
0:26.789 default Q lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(16), reckless_force_counter(5)
0:27.848 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(15), reckless_force_counter(6)
0:28.912 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(14), reckless_force_counter(7)
0:29.666 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(13), reckless_force_counter(7)
0:30.737 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(3), starlord(3), overwhelming_power(12), reckless_force_counter(7)
0:31.492 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(11), reckless_force_counter(7)
0:32.247 default R solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(10), reckless_force_counter(7)
0:33.001 default Q lunar_strike Fluffy_Pillow 79.0/100: 79% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(9), reckless_force_counter(7)
0:34.087 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(8), reckless_force_counter(8)
0:34.945 default R solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(8), reckless_force_counter(9)
0:35.702 default K starsurge Fluffy_Pillow 72.5/100: 73% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(7), reckless_force_counter(9)
0:36.456 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(6), reckless_force_counter(9)
0:37.210 default Q lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(5), reckless_force_counter(9)
0:38.169 default R solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(4), reckless_force_counter(9)
0:38.925 default Q lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(4), reckless_force_counter(9)
0:39.887 default R solar_wrath Fluffy_Pillow 75.5/100: 76% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(3), reckless_force_counter(10)
0:40.646 default M moonfire Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(2), reckless_force_counter(10)
0:41.407 default Q lunar_strike Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar, lunar_empowerment(3), overwhelming_power, reckless_force_counter(10)
0:42.991 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, reckless_force_counter(10)
0:44.241 default N sunfire Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord, reckless_force_counter(10)
0:45.453 default Q lunar_strike Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord, reckless_force_counter(12)
0:46.997 default P stellar_flare Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord, reckless_force_counter(12)
0:48.208 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord, reckless_force_counter(13)
0:49.420 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(3), starlord(2), reckless_force_counter(13)
0:50.422 default Q lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), reckless_force_counter(14)
0:51.921 default Q lunar_strike Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(15)
0:53.422 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(15)
0:54.598 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(15)
0:55.572 default Q lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(15)
0:57.031 default K starsurge Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(16)
0:58.178 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(16)
0:59.153 default Q lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24), reckless_force_counter(16)
1:00.490 default N sunfire Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23), reckless_force_counter(16)
1:01.543 default Q lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), reckless_force_counter(16)
1:02.891 default O moonfire Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), overwhelming_power(21), reckless_force_counter(17)
1:03.952 default R solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(5), solar_empowerment(3), overwhelming_power(20), reckless_force_counter(17)
1:04.939 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(5), solar_empowerment(2), overwhelming_power(19), reckless_force_counter(17)
1:06.105 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(17), reckless_force_counter(17)
1:07.072 default K starsurge Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(25), reckless_force_counter(18)
1:08.180 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(24), reckless_force_counter(18)
1:09.098 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(23), reckless_force_counter(18)
1:10.480 default P stellar_flare Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(22), reckless_force_counter(18)
1:11.568 default Q lunar_strike Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(21), reckless_force_counter(18)
1:12.959 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(20), reckless_force_counter(19)
1:14.054 default H the_unbound_force Fluffy_Pillow 37.5/100: 38% astral_power reckless_force, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(18)
1:15.125 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power reckless_force, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(17)
1:16.042 default Q lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power reckless_force, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16)
1:17.418 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power reckless_force, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(15)
1:18.341 default N sunfire Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14)
1:19.430 default Q lunar_strike Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(13)
1:20.821 default R solar_wrath Fluffy_Pillow 85.0/100: 85% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12), reckless_force_counter
1:21.753 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(11), reckless_force_counter(2)
1:22.853 default R solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10), reckless_force_counter(2)
1:23.669 default Q lunar_strike Fluffy_Pillow 75.0/100: 75% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(9), reckless_force_counter(2)
1:24.898 default J cancel_buff Fluffy_Pillow 92.0/100: 92% astral_power celestial_alignment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(8), reckless_force_counter(2)
1:24.898 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power celestial_alignment, solar_empowerment, torrent_of_elements, overwhelming_power(8), reckless_force_counter(2)
1:25.952 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(7), reckless_force_counter(2)
1:26.825 default K starsurge Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(6), reckless_force_counter(2)
1:27.857 default M moonfire Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(5), reckless_force_counter(4)
1:28.862 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(4), reckless_force_counter(5)
1:30.339 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(2), reckless_force_counter(5)
1:31.829 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power, reckless_force_counter(6)
1:33.004 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, reckless_force_counter(6)
1:33.978 default P stellar_flare Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(6)
1:35.123 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(6)
1:36.584 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), reckless_force_counter(6)
1:37.729 default N sunfire Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(7)
1:38.875 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(7)
1:39.848 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(7)
1:41.307 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), reckless_force_counter(9)
1:42.280 default R solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), reckless_force_counter(9)
1:43.254 default R solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(4), starlord(3), reckless_force_counter(10)
1:44.399 default R solar_wrath Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(4), starlord(3), reckless_force_counter(11)
1:45.545 default K starsurge Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(4), reckless_force_counter(11)
1:46.793 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(11)
1:48.006 default O moonfire Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(11)
1:49.182 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(24), reckless_force_counter(12)
1:50.557 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(23), reckless_force_counter(12)
1:51.938 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(22), reckless_force_counter(12)
1:52.863 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), overwhelming_power(21), reckless_force_counter(12)
1:53.955 default Q lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20), reckless_force_counter(12)
1:55.311 default N sunfire Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(18), reckless_force_counter(12)
1:56.384 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(17), reckless_force_counter(12)
1:57.299 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(16), reckless_force_counter(13)
1:58.219 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), overwhelming_power(15), reckless_force_counter(13)
1:59.304 default P stellar_flare Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(14), reckless_force_counter(13)
2:00.393 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(13), reckless_force_counter(14)
2:01.785 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(12), reckless_force_counter(14)
2:03.181 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(10), reckless_force_counter(15)
2:04.119 default Q lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(9), reckless_force_counter(16), conch_of_dark_whispers
2:05.529 default R solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(8), reckless_force_counter(17), conch_of_dark_whispers
2:06.641 default G use_items Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(8), overwhelming_power(7), reckless_force_counter(17), conch_of_dark_whispers
2:06.641 default K starsurge Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(8), overwhelming_power(7), reckless_force_counter(17), conch_of_dark_whispers, ignition_mages_fuse
2:07.809 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(6), reckless_force_counter(18), conch_of_dark_whispers, ignition_mages_fuse
2:08.653 default K starsurge Fluffy_Pillow 65.0/100: 65% astral_power celestial_alignment, lunar_empowerment, starlord, overwhelming_power(5), reckless_force_counter(19), conch_of_dark_whispers, ignition_mages_fuse
2:09.649 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(4), reckless_force_counter(19), conch_of_dark_whispers, ignition_mages_fuse
2:10.474 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(3), reckless_force_counter(19), conch_of_dark_whispers, ignition_mages_fuse
2:11.711 default H the_unbound_force Fluffy_Pillow 47.0/100: 47% astral_power reckless_force, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(2), conch_of_dark_whispers, ignition_mages_fuse(2)
2:12.650 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power reckless_force, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power, conch_of_dark_whispers, ignition_mages_fuse(2)
2:13.591 default N sunfire Fluffy_Pillow 8.5/100: 9% astral_power reckless_force, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse(2)
2:14.647 default O moonfire Fluffy_Pillow 12.0/100: 12% astral_power reckless_force, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse(3)
2:15.663 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power reckless_force, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse(3)
2:16.959 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(2), conch_of_dark_whispers, ignition_mages_fuse(3)
2:18.256 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), reckless_force_counter(2), conch_of_dark_whispers, ignition_mages_fuse(3)
2:19.272 default R solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(2), ignition_mages_fuse(4)
2:20.103 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(2), ignition_mages_fuse(4)
2:21.349 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(3), reckless_force_counter(2), ignition_mages_fuse(4)
2:22.182 default P stellar_flare Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), reckless_force_counter(3), ignition_mages_fuse(4)
2:23.162 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), reckless_force_counter(3), ignition_mages_fuse(5)
2:23.965 default R solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), reckless_force_counter(4), ignition_mages_fuse(5)
2:24.770 default R solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(3), starlord(3), reckless_force_counter(4), ignition_mages_fuse(5)
2:25.716 default R solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar(3), starlord(3), reckless_force_counter(4), ignition_mages_fuse(5)
2:26.662 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar(3), lunar_empowerment, reckless_force_counter(4)
2:27.911 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord, reckless_force_counter(5)
2:29.125 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(2), reckless_force_counter(5)
2:30.626 default N sunfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(6)
2:31.804 default O moonfire Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(7)
2:32.983 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(8)
2:34.484 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(8)
2:35.661 default R solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(8)
2:36.635 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter(8)
2:38.093 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(9)
2:39.552 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(9)
2:40.698 default R solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(9)
2:41.671 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(10)
2:43.130 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(10)
2:44.587 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), reckless_force_counter(11)
2:45.558 default R solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), reckless_force_counter(12)
2:46.531 default P stellar_flare Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(7), starlord(3), reckless_force_counter(13)
2:47.675 default K starsurge Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(7), reckless_force_counter(14)
2:48.923 default N sunfire Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(14)
2:50.137 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(14)
2:51.681 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(8), solar_empowerment, starlord, reckless_force_counter(16)
2:52.893 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(16)
2:53.765 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), reckless_force_counter(17)
2:55.071 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power celestial_alignment, solar_empowerment, starlord(2), reckless_force_counter(18)
2:56.096 default R solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(18)
2:56.944 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(18)
2:58.214 default H the_unbound_force Fluffy_Pillow 29.0/100: 29% astral_power reckless_force, arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord(3)
2:59.211 default O moonfire Fluffy_Pillow 29.5/100: 30% astral_power reckless_force, arcanic_pulsar, solar_empowerment(2), starlord(3)
3:00.356 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power reckless_force, arcanic_pulsar, solar_empowerment(2), starlord(3)
3:01.331 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power reckless_force, arcanic_pulsar, solar_empowerment, starlord(3)
3:02.477 default Q lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3)
3:03.936 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3)
3:04.909 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3)
3:05.883 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(2), starlord(3), reckless_force_counter
3:07.028 default I celestial_alignment Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(2), celestial_alignment, starlord(3), reckless_force_counter(2)
3:08.025 default E potion Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(2), celestial_alignment, reckless_force_counter(2)
3:08.025 default F berserking Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(2), celestial_alignment, reckless_force_counter(2), battle_potion_of_intellect
3:08.025 default K starsurge Fluffy_Pillow 82.5/100: 83% astral_power berserking, arcanic_pulsar(2), celestial_alignment, reckless_force_counter(2), battle_potion_of_intellect
3:09.012 default N sunfire Fluffy_Pillow 43.5/100: 44% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(2), battle_potion_of_intellect
3:09.971 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(25), reckless_force_counter(2), battle_potion_of_intellect
3:10.847 default P stellar_flare Fluffy_Pillow 7.5/100: 8% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(24), reckless_force_counter(2), battle_potion_of_intellect
3:11.699 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(23), reckless_force_counter(3), battle_potion_of_intellect
3:12.455 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(22), reckless_force_counter(3), battle_potion_of_intellect
3:13.551 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(21), reckless_force_counter(4), battle_potion_of_intellect
3:14.414 default R solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20), reckless_force_counter(4), battle_potion_of_intellect
3:15.168 default O moonfire Fluffy_Pillow 10.5/100: 11% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(19), reckless_force_counter(4), conch_of_dark_whispers, battle_potion_of_intellect
3:16.014 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(18), reckless_force_counter(5), conch_of_dark_whispers, battle_potion_of_intellect
3:16.769 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(18), reckless_force_counter(5), conch_of_dark_whispers, battle_potion_of_intellect
3:17.849 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(17), reckless_force_counter(6), conch_of_dark_whispers, battle_potion_of_intellect
3:18.700 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(16), reckless_force_counter(6), conch_of_dark_whispers, battle_potion_of_intellect
3:19.553 default R solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(15), reckless_force_counter(7), conch_of_dark_whispers, battle_potion_of_intellect
3:20.308 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(14), reckless_force_counter(7), conch_of_dark_whispers, battle_potion_of_intellect
3:21.514 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(13), reckless_force_counter(7), conch_of_dark_whispers, battle_potion_of_intellect
3:22.464 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(12), reckless_force_counter(7), conch_of_dark_whispers, battle_potion_of_intellect
3:23.679 default R solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(6), celestial_alignment, starlord(3), overwhelming_power(11), reckless_force_counter(7), conch_of_dark_whispers, battle_potion_of_intellect
3:24.636 default Q lunar_strike Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(6), celestial_alignment, starlord(3), overwhelming_power(10), reckless_force_counter(8), conch_of_dark_whispers, battle_potion_of_intellect
3:26.074 default L sunfire Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(6), celestial_alignment, starlord(3), overwhelming_power(8), reckless_force_counter(8), conch_of_dark_whispers, battle_potion_of_intellect
3:27.041 default R solar_wrath Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(7), reckless_force_counter(8), conch_of_dark_whispers, battle_potion_of_intellect
3:28.158 default K starsurge Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(6), overwhelming_power(6), reckless_force_counter(8), conch_of_dark_whispers, battle_potion_of_intellect
3:29.379 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(5), reckless_force_counter(9), conch_of_dark_whispers, battle_potion_of_intellect
3:30.569 default Q lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(4), reckless_force_counter(9), battle_potion_of_intellect
3:32.046 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(2), reckless_force_counter(10), battle_potion_of_intellect
3:33.534 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power, reckless_force_counter(10)
3:34.532 default P stellar_flare Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), torrent_of_elements, reckless_force_counter(10)
3:35.708 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), torrent_of_elements, reckless_force_counter(11)
3:36.886 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(11)
3:37.734 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(11)
3:39.003 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power celestial_alignment, solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(12)
3:40.000 default R solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(13)
3:40.848 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(13)
3:42.118 default M moonfire Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(13)
3:43.116 default N sunfire Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(13)
3:44.263 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(13)
3:45.724 default R solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(14), conch_of_dark_whispers
3:46.695 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(15), conch_of_dark_whispers
3:47.667 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, reckless_force_counter(15), conch_of_dark_whispers
3:48.811 default K starsurge Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar, reckless_force_counter(15), conch_of_dark_whispers
3:50.061 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(16), conch_of_dark_whispers
3:51.606 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(2), solar_empowerment, starlord, reckless_force_counter(17), conch_of_dark_whispers
3:52.819 default Q lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(17), conch_of_dark_whispers
3:54.321 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), reckless_force_counter(18), conch_of_dark_whispers
3:55.323 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2), reckless_force_counter(18), conch_of_dark_whispers
3:56.325 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(3), starlord(2), reckless_force_counter(18), conch_of_dark_whispers
3:57.501 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(3), starlord(2), reckless_force_counter(18), conch_of_dark_whispers
3:58.678 default O moonfire Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(18), conch_of_dark_whispers
3:59.823 default P stellar_flare Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(18), conch_of_dark_whispers
4:00.968 default N sunfire Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(19)
4:02.112 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(19)
4:03.571 default H the_unbound_force Fluffy_Pillow 36.5/100: 37% astral_power reckless_force, arcanic_pulsar(4), solar_empowerment, starlord(3)
4:04.716 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power reckless_force, arcanic_pulsar(4), solar_empowerment, starlord(3)
4:05.690 default Q lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power reckless_force, arcanic_pulsar(4), lunar_empowerment, starlord(3)
4:07.149 default G use_items Fluffy_Pillow 63.0/100: 63% astral_power reckless_force, arcanic_pulsar(4), starlord(3)
4:07.149 default R solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power reckless_force, arcanic_pulsar(4), starlord(3), ignition_mages_fuse
4:08.249 default R solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(4), starlord(3), ignition_mages_fuse
4:09.349 default K starsurge Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(4), ignition_mages_fuse
4:10.547 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, ignition_mages_fuse
4:11.709 default Q lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(2), ignition_mages_fuse(2)
4:13.090 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(2), ignition_mages_fuse(2)
4:14.473 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), reckless_force_counter(2), ignition_mages_fuse(2)
4:15.398 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), reckless_force_counter(3), ignition_mages_fuse(3)
4:16.286 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(6), starlord(2), reckless_force_counter(3), ignition_mages_fuse(3)
4:17.330 default Q lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(3), ignition_mages_fuse(3)
4:18.624 default R solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), reckless_force_counter(3), ignition_mages_fuse(3)
4:19.489 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), reckless_force_counter(3), ignition_mages_fuse(4)
4:20.736 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(7), starlord(3), reckless_force_counter(4), ignition_mages_fuse(4)
4:21.715 default Q lunar_strike Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(4), ignition_mages_fuse(4)
4:22.963 default R solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), reckless_force_counter(5), conch_of_dark_whispers, ignition_mages_fuse(4)
4:23.795 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), reckless_force_counter(5), conch_of_dark_whispers, ignition_mages_fuse(5)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="unbound force"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/thorns
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

visions : 39605 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
39605.3 39605.3 39.6 / 0.100% 6841.6 / 17.3% 4628.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.6 8.4 Astral Power 0.00% 59.0 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
visions 39605
Heed My Call 301 (430) 0.8% (1.1%) 8.3 32.86sec 15502 0 Direct 8.3 9197 18395 10858 18.1%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.32 8.32 0.00 0.00 0.0000 0.0000 90379.09 90379.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.82 81.94% 9197.20 8987 9886 9197.09 8987 9886 62726 62726 0.00
crit 1.50 18.06% 18394.98 17974 19771 14399.11 0 19771 27653 27653 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 129 0.3% 8.3 32.86sec 4643 0 Direct 8.3 3941 7888 4643 17.8%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.32 8.32 0.00 0.00 0.0000 0.0000 38646.68 38646.68 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.84 82.21% 3941.20 3852 4237 3941.05 3852 4237 26970 26970 0.00
crit 1.48 17.79% 7887.77 7703 8473 6130.03 0 8473 11677 11677 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5286 13.3% 79.0 3.71sec 20058 15562 Direct 79.0 17005 33998 20058 18.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.99 78.99 0.00 0.00 1.2889 0.0000 1584411.14 1584411.14 0.00 15562.43 15562.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.80 82.03% 17005.04 8968 21459 17007.19 16287 17914 1101896 1101896 0.00
crit 14.19 17.97% 33998.12 17937 42918 33996.77 29944 38131 482516 482516 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2565 6.5% 14.3 21.20sec 53877 53442 Direct 14.3 2907 5811 3429 18.0%  
Periodic 225.7 2706 5404 3189 17.9% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.27 14.27 225.72 225.72 1.0082 1.3190 768875.64 768875.64 0.00 2463.37 53442.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.70 82.01% 2907.23 2614 3599 2907.37 2666 3174 34026 34026 0.00
crit 2.57 17.99% 5810.75 5227 7198 5458.25 0 7198 14916 14916 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 185.3 82.07% 2705.65 2 3351 2705.89 2618 2831 501239 501239 0.00
crit 40.5 17.93% 5404.34 21 6702 5404.22 5031 5815 218695 218695 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 832 2.1% 45.0 6.49sec 5535 0 Direct 45.0 4696 9384 5535 17.9%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.05 45.05 0.00 0.00 0.0000 0.0000 249362.87 249362.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.98 82.10% 4695.96 4220 5812 4696.35 4430 5126 173679 173679 0.00
crit 8.07 17.90% 9384.10 8441 11624 9378.80 0 11624 75684 75684 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2947 (4707) 7.4% (11.9%) 94.5 3.12sec 14937 16844 Direct 95.0 7884 15767 9297 17.9%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.48 95.03 0.00 0.00 0.8868 0.0000 883520.06 883520.06 0.00 16843.64 16843.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.99 82.07% 7883.60 7034 9687 7885.10 7520 8285 614840 614840 0.00
crit 17.04 17.93% 15766.54 14068 19373 15770.13 14381 17591 268680 268680 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1760 4.4% 77.5 3.79sec 6805 0 Direct 77.5 6805 0 6805 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.55 77.55 0.00 0.00 0.0000 0.0000 527707.29 527707.29 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.55 100.00% 6805.15 5135 14142 6805.87 5964 8141 527707 527707 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5134.81
  • base_dd_max:5134.81
  • base_dd_mult:1.00
 
Starsurge 12750 32.2% 64.2 4.72sec 59582 57629 Direct 63.9 50721 101378 59805 17.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.16 63.92 0.00 0.00 1.0339 0.0000 3822591.70 3822591.70 0.00 57629.04 57629.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.46 82.07% 50720.93 45503 62210 50719.87 48303 53584 2660587 2660587 0.00
crit 11.46 17.93% 101378.37 91007 124420 101359.46 91007 119772 1162005 1162005 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1664 4.2% 12.8 23.57sec 39020 37824 Direct 12.8 2475 4949 2915 17.8%  
Periodic 223.3 1753 3504 2067 17.9% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.78 12.78 223.31 223.31 1.0317 1.3218 498820.27 498820.27 0.00 1617.67 37823.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.51 82.23% 2475.22 2253 3103 2475.65 2253 2701 26020 26020 0.00
crit 2.27 17.77% 4948.94 4506 6205 4528.87 0 6205 11240 11240 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 183.3 82.09% 1753.23 36 2172 1753.39 1700 1841 321402 321402 0.00
crit 40.0 17.91% 3504.39 2 4344 3504.47 3264 3775 140158 140158 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 8519 21.5% 131.3 2.20sec 19480 0 Direct 131.3 16516 33035 19480 17.9%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 131.26 131.26 0.00 0.00 0.0000 0.0000 2556957.36 2556957.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 107.71 82.06% 16515.82 16140 17753 16515.19 16140 17378 1778895 1778895 0.00
crit 23.55 17.94% 33035.04 32279 35507 33034.64 32279 35167 778063 778063 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2853 7.2% 18.0 16.68sec 47541 47095 Direct 18.0 4020 8039 4737 17.8%  
Periodic 224.8 2906 5808 3425 17.9% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.99 17.99 224.84 224.84 1.0095 1.3201 855294.00 855294.00 0.00 2715.45 47095.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.78 82.16% 4019.63 3605 4964 4019.42 3696 4403 59416 59416 0.00
crit 3.21 17.84% 8038.85 7210 9929 7793.33 0 9929 25799 25799 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 184.6 82.10% 2905.65 2 3599 2905.88 2813 3044 536388 536388 0.00
crit 40.2 17.90% 5807.64 41 7198 5807.72 5425 6293 233691 233691 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
visions
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:visions
  • harmful:false
  • if_expr:
 
Berserking 2.0 188.47sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.4 154.46sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.38 0.00 0.00 0.00 0.9079 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:150.388
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:visions
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:visions
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.6 56.4 42.5sec 4.7sec 93.10% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.32%
  • arcanic_pulsar_2:10.82%
  • arcanic_pulsar_3:11.51%
  • arcanic_pulsar_4:10.81%
  • arcanic_pulsar_5:13.05%
  • arcanic_pulsar_6:11.06%
  • arcanic_pulsar_7:11.04%
  • arcanic_pulsar_8:13.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 111.9sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 188.4sec 188.4sec 8.11% 8.18% 0.0(0.0) 2.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 10.0 0.0 31.1sec 31.1sec 38.88% 46.62% 0.0(0.0) 9.5

Buff details

  • buff initial source:visions
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:38.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.1 61.1sec 45.9sec 23.54% 0.00% 1.1(1.1) 4.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 2.4 0.0 154.6sec 154.6sec 15.20% 0.00% 2.2(2.2) 2.2

Buff details

  • buff initial source:visions
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.12%
  • ignition_mages_fuse_2:3.08%
  • ignition_mages_fuse_3:3.04%
  • ignition_mages_fuse_4:3.00%
  • ignition_mages_fuse_5:2.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 28.9 54.3 10.4sec 3.6sec 85.82% 98.97% 3.3(3.3) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:32.20%
  • lunar_empowerment_2:32.97%
  • lunar_empowerment_3:20.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.6 3.6 64.6sec 33.6sec 48.22% 0.00% 3.6(49.5) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.46%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.63%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.72%
  • overwhelming_power_10:1.77%
  • overwhelming_power_11:1.82%
  • overwhelming_power_12:1.88%
  • overwhelming_power_13:1.93%
  • overwhelming_power_14:1.99%
  • overwhelming_power_15:2.05%
  • overwhelming_power_16:2.11%
  • overwhelming_power_17:2.18%
  • overwhelming_power_18:2.24%
  • overwhelming_power_19:2.31%
  • overwhelming_power_20:2.39%
  • overwhelming_power_21:2.46%
  • overwhelming_power_22:2.54%
  • overwhelming_power_23:2.62%
  • overwhelming_power_24:2.69%
  • overwhelming_power_25:1.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 27.8 52.1 10.7sec 3.8sec 84.79% 81.68% 0.3(0.3) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:30.31%
  • solar_empowerment_2:38.10%
  • solar_empowerment_3:16.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.4 48.8 20.1sec 4.7sec 97.96% 92.98% 18.3(18.3) 10.7

Buff details

  • buff initial source:visions
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.12%
  • starlord_2:21.97%
  • starlord_3:61.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.3sec 45.8sec 23.59% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.59%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Vision of Perfection 4.1 0.6 60.6sec 50.9sec 14.27% 0.00% 0.6(0.6) 3.9

Buff details

  • buff initial source:visions
  • cooldown name:buff_vision_of_perfection
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:116.09

Stack Uptimes

  • vision_of_perfection_1:14.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:303344
  • name:Vision of Perfection
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc303342=When Vision of Perfection activates, you and {$s1=2} other nearby allies gain {$s2=0} Haste for {$303344d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
visions
starsurge Astral Power 64.2 2566.3 40.0 40.0 1489.6
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 95.48 763.29 (30.17%) 7.99 0.55 0.07%
celestial_alignment Astral Power 2.38 95.05 (3.76%) 40.00 0.00 0.00%
sunfire Astral Power 17.99 53.97 (2.13%) 3.00 0.00 0.00%
shooting_stars Astral Power 45.05 180.16 (7.12%) 4.00 0.04 0.02%
moonfire Astral Power 14.27 42.81 (1.69%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.78 102.25 (4.04%) 8.00 0.02 0.02%
lunar_strike Astral Power 78.99 947.40 (37.45%) 11.99 0.47 0.05%
natures_balance Astral Power 400.43 200.20 (7.91%) 0.50 0.02 0.01%
arcanic_pulsar Astral Power 6.66 79.90 (3.16%) 12.00 0.00 0.00%
vision_of_perfection Astral Power 4.66 65.07 (2.57%) 13.97 0.13 0.20%
Resource RPS-Gain RPS-Loss
Astral Power 8.44 8.56
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 21.32 0.00 93.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data visions Fight Length
Count 7600
Mean 299.94
Minimum 240.00
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data visions Damage Per Second
Count 7600
Mean 39605.27
Minimum 34453.69
Maximum 47994.35
Spread ( max - min ) 13540.66
Range [ ( max - min ) / 2 * 100% ] 17.09%
Standard Deviation 1760.4487
5th Percentile 36859.06
95th Percentile 42665.89
( 95th Percentile - 5th Percentile ) 5806.83
Mean Distribution
Standard Deviation 20.1937
95.00% Confidence Intervall ( 39565.69 - 39644.85 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 76
0.1% Error 7590
0.1 Scale Factor Error with Delta=300 26457
0.05 Scale Factor Error with Delta=300 105826
0.01 Scale Factor Error with Delta=300 2645638
Priority Target DPS
Sample Data visions Priority Target Damage Per Second
Count 7600
Mean 39605.27
Minimum 34453.69
Maximum 47994.35
Spread ( max - min ) 13540.66
Range [ ( max - min ) / 2 * 100% ] 17.09%
Standard Deviation 1760.4487
5th Percentile 36859.06
95th Percentile 42665.89
( 95th Percentile - 5th Percentile ) 5806.83
Mean Distribution
Standard Deviation 20.1937
95.00% Confidence Intervall ( 39565.69 - 39644.85 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 76
0.1% Error 7590
0.1 Scale Factor Error with Delta=300 26457
0.05 Scale Factor Error with Delta=300 105826
0.01 Scale Factor Error with Delta=300 2645638
DPS(e)
Sample Data visions Damage Per Second (Effective)
Count 7600
Mean 39605.27
Minimum 34453.69
Maximum 47994.35
Spread ( max - min ) 13540.66
Range [ ( max - min ) / 2 * 100% ] 17.09%
Damage
Sample Data visions Damage
Count 7600
Mean 11876566.09
Minimum 8749921.26
Maximum 15865079.39
Spread ( max - min ) 7115158.13
Range [ ( max - min ) / 2 * 100% ] 29.95%
DTPS
Sample Data visions Damage Taken Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data visions Healing Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data visions Healing Per Second (Effective)
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data visions Heal
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data visions Healing Taken Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data visions Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data visionsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data visions Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.37 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 thorns
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.38 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
I 3.74 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
J 64.16 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
K 3.64 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
L 3.17 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
M 13.81 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
N 11.10 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 12.78 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 79.29 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 94.73 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.54 sunfire

Sample Sequence

0123456789ACDJNMOHFGJQJQPQJQPQPJQMQPNQPQJOJQKPPJPPQQPQQQJQPJQPQJJMNOPQPJQPJQPQPQMJNPJQPPJOQPQQQMQQJQJQPJLPJPPOJMQPPPJQPNJQPQQJPMPOQQQQJJQPQJQLPMJPPPQQQOJJPPPJMNQPQHEGJQPQPIJQJQOQPJMQPJNQPJQPQPQPJJPMPJOQPNJQPQQQQJMFJQPQPJQPJOQPQJNPQQMJPQQQJPQQQJPNOMQPQJQJQPJPPQQQQPQJQPQIJJ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask visions 58.0/100: 58% astral_power
Pre precombat 1 food visions 58.0/100: 58% astral_power
Pre precombat 2 augmentation visions 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.248 default N moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.181 default M sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.114 default O stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.048 default H celestial_alignment Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.860 default F berserking Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.860 default G use_items Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.860 default J starsurge Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:05.614 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:06.370 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.124 default Q solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:07.880 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.734 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.488 default J starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.243 default Q solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.998 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.816 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.571 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.390 default J starsurge Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.144 default Q solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.897 default M sunfire Fluffy_Pillow 17.5/100: 18% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.650 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.403 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.192 default N moonfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.946 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.700 default P lunar_strike Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.536 default Q solar_wrath Fluffy_Pillow 75.0/100: 75% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.290 default J starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.045 default O stellar_flare Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.799 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.553 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.308 default K sunfire Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), ignition_mages_fuse(5)
0:24.065 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord(2), ignition_mages_fuse(5)
0:25.019 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2)
0:26.173 default J starsurge Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2)
0:27.080 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:28.204 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
0:29.328 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3)
0:30.084 default Q solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3)
0:30.839 default P lunar_strike Fluffy_Pillow 53.5/100: 54% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3)
0:31.963 default Q solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, arcanic_pulsar(8), starlord(3)
0:32.845 default Q solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power bloodlust, arcanic_pulsar(8), starlord(3)
0:33.727 default Q solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar(8), starlord(3)
0:34.609 default J starsurge Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, arcanic_pulsar(8), starlord(3)
0:35.491 default Q solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3)
0:36.246 default P lunar_strike Fluffy_Pillow 73.0/100: 73% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements
0:37.224 default J starsurge Fluffy_Pillow 89.5/100: 90% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements
0:37.991 default Q solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements
0:38.746 default P lunar_strike Fluffy_Pillow 58.5/100: 59% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements
0:39.723 default Q solar_wrath Fluffy_Pillow 71.0/100: 71% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
0:40.478 default J starsurge Fluffy_Pillow 79.5/100: 80% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, torrent_of_elements
0:41.315 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements
0:42.527 default M sunfire Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements
0:43.705 default N moonfire Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements
0:44.883 default O stellar_flare Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements
0:46.060 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements
0:47.559 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements
0:48.561 default P lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
0:50.061 default J starsurge Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
0:51.236 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:52.209 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), vision_of_perfection
0:53.460 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), vision_of_perfection
0:54.442 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), vision_of_perfection
0:55.278 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), vision_of_perfection
0:56.529 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), vision_of_perfection
0:57.364 default P lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), vision_of_perfection
0:58.615 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), vision_of_perfection
0:59.576 default M sunfire Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(5), starlord(3), vision_of_perfection
1:00.706 default J starsurge Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(5), vision_of_perfection
1:01.937 default N moonfire Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord
1:03.148 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord
1:04.691 default J starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord
1:05.904 default Q solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2)
1:06.904 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:08.403 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2)
1:09.903 default J starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2)
1:11.080 default O stellar_flare Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3)
1:12.226 default Q solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3)
1:13.200 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
1:14.660 default Q solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3)
1:15.634 default Q solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3)
1:16.608 default Q solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(8), starlord(3)
1:17.754 default M sunfire Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(8), starlord(3)
1:18.899 default Q solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(8), starlord(3)
1:20.045 default Q solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(8), starlord(3)
1:21.190 default J starsurge Fluffy_Pillow 92.0/100: 92% astral_power arcanic_pulsar(8), lunar_empowerment
1:22.437 default Q solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord
1:23.334 default J starsurge Fluffy_Pillow 73.5/100: 74% astral_power celestial_alignment, lunar_empowerment(2), starlord
1:24.390 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2)
1:25.262 default P lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2)
1:26.566 default J starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2)
1:27.589 default L moonfire Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3)
1:28.585 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3)
1:30.043 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3)
1:31.187 default P lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(24)
1:32.524 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23)
1:33.868 default O stellar_flare Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22)
1:34.926 default J starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21)
1:35.988 default M sunfire Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(20)
1:37.054 default Q solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(18), conch_of_dark_whispers
1:37.965 default P lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(18), conch_of_dark_whispers
1:39.333 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16), conch_of_dark_whispers
1:40.709 default P lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15), conch_of_dark_whispers
1:42.089 default J starsurge Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(4), solar_empowerment(2), overwhelming_power(13), conch_of_dark_whispers
1:43.279 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(12), conch_of_dark_whispers
1:44.266 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(11), conch_of_dark_whispers
1:45.747 default N moonfire Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, overwhelming_power(24), conch_of_dark_whispers
1:46.859 default J starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, overwhelming_power(23), conch_of_dark_whispers
1:47.975 default Q solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(22), conch_of_dark_whispers
1:48.900 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(21), conch_of_dark_whispers
1:50.291 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(19), conch_of_dark_whispers
1:51.225 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), overwhelming_power(18), conch_of_dark_whispers
1:52.163 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(2), overwhelming_power(17)
1:53.270 default P lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(16)
1:54.645 default M sunfire Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15)
1:55.729 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14)
1:57.115 default O stellar_flare Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(3), overwhelming_power(12)
1:58.212 default Q solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(3), overwhelming_power(11)
1:59.148 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(10)
2:00.087 default Q solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(9)
2:01.029 default Q solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(8)
2:02.142 default J starsurge Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(7), lunar_empowerment, overwhelming_power(7)
2:03.357 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(6)
2:04.542 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(5)
2:05.397 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(4)
2:06.682 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(3)
2:07.543 default J starsurge Fluffy_Pillow 47.0/100: 47% astral_power celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(2)
2:08.560 default Q solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power
2:09.403 default L moonfire Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3)
2:10.401 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar, lunar_empowerment(3), starlord(3)
2:11.862 default M sunfire Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3)
2:13.006 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3)
2:14.153 default P lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3)
2:15.611 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3)
2:17.070 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3)
2:18.530 default Q solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(2), solar_empowerment(3), starlord(3)
2:19.503 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), torrent_of_elements
2:20.475 default Q solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), torrent_of_elements
2:21.448 default O stellar_flare Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), torrent_of_elements
2:22.594 default J starsurge Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(2), lunar_empowerment, torrent_of_elements
2:23.841 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements
2:25.051 default P lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements
2:26.551 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
2:28.051 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
2:29.552 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements
2:30.729 default M sunfire Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
2:31.876 default N moonfire Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(24)
2:32.928 default Q solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(23)
2:33.825 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22)
2:35.174 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(20)
2:36.081 default H celestial_alignment Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(19)
2:37.010 default E potion Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(18)
2:37.010 default G use_items Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(18), battle_potion_of_intellect
2:37.010 default J starsurge Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse
2:37.907 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse
2:38.671 default P lunar_strike Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse
2:39.818 default Q solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(16), battle_potion_of_intellect, ignition_mages_fuse
2:40.588 default P lunar_strike Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(15), battle_potion_of_intellect, ignition_mages_fuse
2:41.744 default I cancel_buff Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(6), celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(14), battle_potion_of_intellect, ignition_mages_fuse(2)
2:41.744 default J starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(6), celestial_alignment, solar_empowerment, overwhelming_power(14), battle_potion_of_intellect, ignition_mages_fuse(2)
2:42.699 default Q solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(13), battle_potion_of_intellect, ignition_mages_fuse(2)
2:43.492 default J starsurge Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(12), battle_potion_of_intellect, ignition_mages_fuse(2)
2:44.426 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(11), battle_potion_of_intellect, ignition_mages_fuse(2)
2:45.198 default O stellar_flare Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(10), battle_potion_of_intellect, ignition_mages_fuse(3)
2:46.078 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(9), battle_potion_of_intellect, ignition_mages_fuse(3)
2:46.832 default P lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(9), battle_potion_of_intellect, ignition_mages_fuse(3)
2:47.955 default J starsurge Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(8), battle_potion_of_intellect, ignition_mages_fuse(3)
2:48.840 default M sunfire Fluffy_Pillow 38.5/100: 39% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(7), battle_potion_of_intellect, ignition_mages_fuse(3)
2:49.705 default Q solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(6), battle_potion_of_intellect, ignition_mages_fuse(4)
2:50.460 default P lunar_strike Fluffy_Pillow 50.5/100: 51% astral_power celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(5), battle_potion_of_intellect, ignition_mages_fuse(4)
2:51.528 default J starsurge Fluffy_Pillow 63.0/100: 63% astral_power celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(4), battle_potion_of_intellect, ignition_mages_fuse(4)
2:52.369 default N moonfire Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(3), battle_potion_of_intellect, ignition_mages_fuse(4)
2:53.213 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(2), battle_potion_of_intellect, ignition_mages_fuse(5)
2:53.969 default P lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(2), battle_potion_of_intellect, ignition_mages_fuse(5)
2:55.011 default J starsurge Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(5)
2:55.833 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(5)
2:56.587 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(5)
2:57.633 default Q solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect
2:58.631 default P lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect
2:59.901 default Q solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), battle_potion_of_intellect
3:00.750 default P lunar_strike Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, starlord(3), battle_potion_of_intellect
3:02.017 default J starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(2), celestial_alignment
3:03.103 default J starsurge Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord
3:04.316 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2)
3:05.816 default M sunfire Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2)
3:06.993 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2)
3:08.493 default J starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2)
3:09.671 default O stellar_flare Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3)
3:10.818 default Q solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3)
3:11.792 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3)
3:13.252 default N moonfire Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3)
3:14.396 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3)
3:15.540 default Q solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3)
3:16.514 default P lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
3:17.974 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3)
3:18.948 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3)
3:19.922 default Q solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(6), starlord(3)
3:21.067 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(6), starlord(3)
3:22.213 default J starsurge Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(6), torrent_of_elements
3:23.462 default M sunfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
3:24.674 default F berserking Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, vision_of_perfection
3:24.674 default J starsurge Fluffy_Pillow 43.0/100: 43% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, vision_of_perfection
3:25.621 default Q solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power berserking, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, vision_of_perfection
3:26.402 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power berserking, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, vision_of_perfection
3:27.572 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power berserking, arcanic_pulsar(8), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, vision_of_perfection
3:28.352 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power berserking, arcanic_pulsar(8), celestial_alignment, lunar_empowerment, starlord(2), torrent_of_elements, vision_of_perfection
3:29.521 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power berserking, arcanic_pulsar(8), celestial_alignment, starlord(2), torrent_of_elements, vision_of_perfection
3:30.440 default Q solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power berserking, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, vision_of_perfection
3:31.200 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power berserking, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, vision_of_perfection
3:32.338 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power berserking, celestial_alignment, starlord(3), torrent_of_elements, vision_of_perfection
3:33.232 default O stellar_flare Fluffy_Pillow 1.0/100: 1% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, vision_of_perfection
3:34.126 default Q solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
3:34.895 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements
3:36.051 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(3), torrent_of_elements
3:36.959 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, celestial_alignment, starlord(3), overwhelming_power(25)
3:37.870 default N moonfire Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24)
3:38.921 default P lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(23)
3:40.264 default Q solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(21), conch_of_dark_whispers
3:41.166 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(20), conch_of_dark_whispers
3:42.233 default M sunfire Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(2), overwhelming_power(19), conch_of_dark_whispers
3:43.398 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(2), overwhelming_power(18), conch_of_dark_whispers
3:44.567 default P lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(17), conch_of_dark_whispers
3:46.016 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(3), solar_empowerment, starlord, overwhelming_power(15), conch_of_dark_whispers
3:46.991 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(3), starlord, overwhelming_power(15), conch_of_dark_whispers
3:48.138 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(3), starlord, overwhelming_power(13), conch_of_dark_whispers
3:49.294 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(3), starlord, overwhelming_power(12), conch_of_dark_whispers
3:50.452 default P lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(11), conch_of_dark_whispers
3:51.893 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(24), conch_of_dark_whispers
3:52.811 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), overwhelming_power(23), conch_of_dark_whispers
3:53.732 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(4), starlord(2), overwhelming_power(22), conch_of_dark_whispers
3:54.821 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(4), starlord(2), overwhelming_power(21)
3:55.911 default P lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(20)
3:57.268 default N moonfire Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(18)
3:58.340 default O stellar_flare Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(17)
3:59.417 default M sunfire Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(16)
4:00.498 default Q solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(15)
4:01.423 default P lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(5), celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(25), vision_of_perfection
4:02.771 default Q solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(5), celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(24), vision_of_perfection
4:03.540 default J starsurge Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar(5), celestial_alignment, overwhelming_power(23), vision_of_perfection
4:04.528 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(22), vision_of_perfection
4:05.346 default J starsurge Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord, overwhelming_power(21), vision_of_perfection
4:06.312 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(20), vision_of_perfection
4:07.113 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(19), vision_of_perfection
4:08.316 default J starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(18), vision_of_perfection, conch_of_dark_whispers
4:09.264 default P lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(17), vision_of_perfection, conch_of_dark_whispers
4:10.616 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(16), vision_of_perfection, conch_of_dark_whispers
4:11.973 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(15), conch_of_dark_whispers
4:12.896 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers
4:13.985 default Q solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(13), conch_of_dark_whispers
4:15.076 default Q solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(11), conch_of_dark_whispers
4:16.176 default P lunar_strike Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(10), conch_of_dark_whispers
4:17.582 default Q solar_wrath Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(9), conch_of_dark_whispers
4:18.691 default J starsurge Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(8), conch_of_dark_whispers
4:19.803 default Q solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25), conch_of_dark_whispers
4:20.579 default P lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers
4:21.742 default Q solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers
4:22.660 default I cancel_buff Fluffy_Pillow 92.0/100: 92% astral_power celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers
4:22.660 default J starsurge Fluffy_Pillow 92.0/100: 92% astral_power celestial_alignment, torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers
4:23.661 default J starsurge Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(21), vision_of_perfection

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 5.59% 5.59% 475
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="visions"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/thorns
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

worldvein : 36715 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
36715.1 36715.1 25.6 / 0.070% 4396.2 / 12.0% 4545.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 7.9 Astral Power 0.00% 57.9 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
worldvein 36715
Heed My Call 293 (419) 0.8% (1.1%) 8.2 33.33sec 15355 0 Direct 8.2 9107 18215 10749 18.0%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.18 8.18 0.00 0.00 0.0000 0.0000 87883.62 87883.62 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.70 81.98% 9106.55 8901 9791 9104.93 0 9791 61039 61039 0.00
crit 1.47 18.02% 18215.36 17802 19582 14070.95 0 19582 26844 26844 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 126 0.3% 8.2 33.33sec 4607 0 Direct 8.2 3903 7804 4606 18.0%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.18 8.18 0.00 0.00 0.0000 0.0000 37667.42 37667.42 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.70 81.96% 3903.11 3815 4196 3903.53 3815 4196 26157 26157 0.00
crit 1.48 18.04% 7803.88 7629 8392 6073.93 0 8392 11511 11511 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5327 14.5% 76.0 3.85sec 21004 16044 Direct 76.0 17799 35578 21004 18.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.01 76.01 0.00 0.00 1.3092 0.0000 1596440.80 1596440.80 0.00 16043.50 16043.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.30 81.97% 17799.37 9382 22717 17806.56 17133 18655 1108969 1108969 0.00
crit 13.70 18.03% 35578.25 19095 45434 35593.84 31544 41319 487472 487472 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2619 7.1% 14.1 21.30sec 55665 54452 Direct 14.1 3058 6115 3601 17.8%  
Periodic 220.8 2818 5631 3323 18.0% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.09 14.09 220.76 220.76 1.0223 1.3442 784436.17 784436.17 0.00 2520.97 54452.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.59 82.24% 3058.29 2637 3810 3059.94 2805 3396 35442 35442 0.00
crit 2.50 17.76% 6115.29 5274 7620 5706.99 0 7620 15309 15309 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.1 82.04% 2818.20 4 3547 2819.43 2738 2938 510413 510413 0.00
crit 39.6 17.96% 5631.19 4 7095 5633.56 5283 6084 223273 223273 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 845 2.3% 43.9 6.64sec 5768 0 Direct 43.9 4890 9772 5768 18.0%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.89 43.89 0.00 0.00 0.0000 0.0000 253203.48 253203.48 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.99 82.00% 4889.62 4180 6153 4891.72 4608 5399 175990 175990 0.00
crit 7.90 18.00% 9771.75 8360 12305 9770.61 0 12305 77213 77213 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2964 (4694) 8.1% (12.8%) 91.5 3.21sec 15378 17060 Direct 92.0 8189 16365 9653 17.9%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.45 91.98 0.00 0.00 0.9014 0.0000 887924.58 887924.58 0.00 17059.79 17059.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.51 82.09% 8189.04 6967 10255 8193.46 7929 8581 618380 618380 0.00
crit 16.47 17.91% 16365.48 14193 20509 16374.67 14977 18899 269545 269545 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1730 4.7% 73.3 3.99sec 7073 0 Direct 73.3 7073 0 7073 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.30 73.30 0.00 0.00 0.0000 0.0000 518450.10 518450.10 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.30 100.00% 7073.24 5086 14972 7076.78 6114 8242 518450 518450 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5466.49
  • base_dd_max:5466.49
  • base_dd_mult:1.00
 
Starsurge 12452 33.9% 60.4 4.99sec 61708 58704 Direct 60.2 52483 104887 61897 18.0%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.43 60.25 0.00 0.00 1.0512 0.0000 3729073.75 3729073.75 0.00 58704.31 58704.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.42 82.03% 52483.26 45067 65508 52506.45 50539 55095 2593799 2593799 0.00
crit 10.82 17.97% 104886.81 90135 131016 104930.78 95363 122967 1135274 1135274 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1699 4.6% 12.7 23.57sec 39944 38430 Direct 12.7 2567 5128 3024 17.8%  
Periodic 218.4 1826 3651 2154 18.0% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.74 12.74 218.41 218.41 1.0394 1.3470 509049.97 509049.97 0.00 1655.79 38430.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.47 82.16% 2567.01 2231 3285 2568.00 2399 2807 26879 26879 0.00
crit 2.27 17.84% 5127.51 4546 6569 4689.61 0 6569 11656 11656 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 179.2 82.03% 1826.43 13 2299 1827.24 1775 1902 327227 327227 0.00
crit 39.2 17.97% 3650.64 137 4599 3652.26 3459 3930 143287 143287 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5743 15.6% 88.7 3.13sec 19281 0 Direct 88.7 16354 32711 19281 17.9%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.73 88.73 0.00 0.00 0.0000 0.0000 1710784.79 1710784.79 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.85 82.10% 16353.55 15985 17583 16352.79 15985 17218 1191295 1191295 0.00
crit 15.88 17.90% 32711.17 31970 35167 32714.88 31970 35167 519490 519490 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2917 8.0% 17.9 16.61sec 48674 47409 Direct 17.9 4194 8395 4940 17.8%  
Periodic 219.9 3027 6048 3570 18.0% 98.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.95 17.95 219.91 219.91 1.0267 1.3453 873661.59 873661.59 0.00 2779.85 47409.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.76 82.24% 4194.26 3570 5255 4195.08 3911 4517 61914 61914 0.00
crit 3.19 17.76% 8394.65 7141 10511 8127.21 0 10511 26759 26759 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.4 82.04% 3026.95 2 3810 3028.26 2943 3152 546105 546105 0.00
crit 39.5 17.96% 6047.68 18 7620 6050.53 5512 6582 238883 238883 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
worldvein
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worldvein
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.38sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.16sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9039 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worldvein
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worldvein
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Worldvein Resonance 5.5 60.37sec

Stats details: worldvein_resonance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.47 0.00 0.00 0.00 1.1469 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: worldvein_resonance

Static Values
  • id:295186
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295186
  • name:Worldvein Resonance
  • school:physical
  • tooltip:
  • description:Concentrate energy into the Heart of Azeroth, immediately causing {$s1=2} Lifeblood Shards to erupt from the nearby ground for {$295114d=12 seconds}. $@spellicon295078$@spellname295114 Grants you and any other ally using Worldvein Resonance {$295078s5=55} primary stat while within {$295078s2=8} yds of the Lifeblood Shard. You can benefit from a maximum of {$295137u=4} Lifeblood Shards at a time.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.1 53.1 44.7sec 5.0sec 92.82% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.30%
  • arcanic_pulsar_2:10.26%
  • arcanic_pulsar_3:11.33%
  • arcanic_pulsar_4:10.63%
  • arcanic_pulsar_5:13.74%
  • arcanic_pulsar_6:10.35%
  • arcanic_pulsar_7:10.84%
  • arcanic_pulsar_8:14.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 189.2sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.4sec 182.4sec 8.11% 7.75% 0.0(0.0) 2.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.7sec 37.7sec 25.76% 32.50% 0.0(0.0) 8.1

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.1 60.7sec 45.5sec 23.67% 0.00% 1.1(1.1) 4.1

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.17% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.94%
  • ignition_mages_fuse_2:3.88%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lifeblood 94.2 0.0 153.9sec 3.2sec 99.98% 0.00% 84.5(97.8) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_lifeblood
  • max_stacks:4
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:190.14

Stack Uptimes

  • lifeblood_1:0.10%
  • lifeblood_2:0.83%
  • lifeblood_3:5.78%
  • lifeblood_4:93.27%

Trigger Attempt Success

  • trigger_pct:94.33%

Spelldata details

  • id:295137
  • name:Lifeblood
  • tooltip:$?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] increased by ${$w1+$w2+$w3}.
  • description:{$@spelldesc295078=Every {$s4=18}-{$s1=25} sec, a Lifeblood Shard erupts from the nearby ground for {$295114d=12 seconds}.$?!s295186&a295078[ $@spellicon295078$@spellname295114 Grants you and any other ally using Worldvein Resonance {$295078s5=55} primary stat while within ${$m2*(1+($295160m1/100))} yds of the Lifeblood Shard. You can benefit from a maximum of {$295137u=4} Lifeblood Shards at a time.][]}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 33.5 45.4 9.0sec 3.8sec 81.92% 99.70% 1.8(1.8) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.21%
  • lunar_empowerment_2:31.63%
  • lunar_empowerment_3:14.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.5 3.4 64.8sec 34.3sec 47.52% 0.00% 3.4(47.1) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.44%
  • overwhelming_power_4:1.48%
  • overwhelming_power_5:1.52%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.61%
  • overwhelming_power_8:1.65%
  • overwhelming_power_9:1.70%
  • overwhelming_power_10:1.75%
  • overwhelming_power_11:1.80%
  • overwhelming_power_12:1.85%
  • overwhelming_power_13:1.91%
  • overwhelming_power_14:1.96%
  • overwhelming_power_15:2.02%
  • overwhelming_power_16:2.08%
  • overwhelming_power_17:2.14%
  • overwhelming_power_18:2.21%
  • overwhelming_power_19:2.28%
  • overwhelming_power_20:2.34%
  • overwhelming_power_21:2.41%
  • overwhelming_power_22:2.49%
  • overwhelming_power_23:2.56%
  • overwhelming_power_24:2.63%
  • overwhelming_power_25:1.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 24.3 51.3 12.1sec 4.0sec 85.69% 79.80% 0.3(0.3) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.08%
  • solar_empowerment_2:39.63%
  • solar_empowerment_3:17.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.3 20.3sec 5.0sec 97.02% 92.01% 15.4(15.4) 11.4

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.88%
  • starlord_2:22.49%
  • starlord_3:59.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.4sec 45.6sec 23.65% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.65%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
worldvein
starsurge Astral Power 60.4 2417.2 40.0 40.0 1542.7
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 92.45 739.58 (31.08%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.36%) 40.00 0.00 0.00%
sunfire Astral Power 17.95 53.85 (2.26%) 3.00 0.00 0.00%
shooting_stars Astral Power 43.89 175.57 (7.38%) 4.00 0.01 0.00%
moonfire Astral Power 14.09 42.28 (1.78%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.74 101.95 (4.28%) 8.00 0.00 0.00%
lunar_strike Astral Power 76.01 912.01 (38.32%) 12.00 0.06 0.01%
natures_balance Astral Power 400.43 200.21 (8.41%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.20 74.36 (3.12%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.93 8.06
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.04 0.00 80.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data worldvein Fight Length
Count 7600
Mean 299.94
Minimum 240.00
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data worldvein Damage Per Second
Count 7600
Mean 36715.08
Minimum 33317.04
Maximum 41118.55
Spread ( max - min ) 7801.51
Range [ ( max - min ) / 2 * 100% ] 10.62%
Standard Deviation 1137.8683
5th Percentile 34910.86
95th Percentile 38648.72
( 95th Percentile - 5th Percentile ) 3737.86
Mean Distribution
Standard Deviation 13.0522
95.00% Confidence Intervall ( 36689.50 - 36740.66 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3690
0.1 Scale Factor Error with Delta=300 11053
0.05 Scale Factor Error with Delta=300 44211
0.01 Scale Factor Error with Delta=300 1105269
Priority Target DPS
Sample Data worldvein Priority Target Damage Per Second
Count 7600
Mean 36715.08
Minimum 33317.04
Maximum 41118.55
Spread ( max - min ) 7801.51
Range [ ( max - min ) / 2 * 100% ] 10.62%
Standard Deviation 1137.8683
5th Percentile 34910.86
95th Percentile 38648.72
( 95th Percentile - 5th Percentile ) 3737.86
Mean Distribution
Standard Deviation 13.0522
95.00% Confidence Intervall ( 36689.50 - 36740.66 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3690
0.1 Scale Factor Error with Delta=300 11053
0.05 Scale Factor Error with Delta=300 44211
0.01 Scale Factor Error with Delta=300 1105269
DPS(e)
Sample Data worldvein Damage Per Second (Effective)
Count 7600
Mean 36715.08
Minimum 33317.04
Maximum 41118.55
Spread ( max - min ) 7801.51
Range [ ( max - min ) / 2 * 100% ] 10.62%
Damage
Sample Data worldvein Damage
Count 7600
Mean 10988576.28
Minimum 8732256.08
Maximum 13721921.56
Spread ( max - min ) 4989665.48
Range [ ( max - min ) / 2 * 100% ] 22.70%
DTPS
Sample Data worldvein Damage Taken Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data worldvein Healing Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data worldvein Healing Per Second (Effective)
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data worldvein Heal
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data worldvein Healing Taken Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data worldvein Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data worldveinTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data worldvein Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.94 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 thorns
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
H 5.47 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.77 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 60.43 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.07 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.78 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.51 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.31 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.74 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 76.36 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 91.72 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.36 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRKRQKRQRQKRQRNRORQRJKRKPRLQKQRQQRQRKRKRQRQRMKKNQPKRQQKRQRQRQHKNOKRQQPKRQRRRRRNRJKRKRQKMQQKQPQNRRRRKKQOQRKQRRRKNPQHQRKGRQKORKRQLQKRQQRQPRRKKQQOKNRQRKQRRRQRRKPKNQOQQKRQKRHLQQIEFKRKPRQRORKRQKRQKNRQMQKQQRKPRQKNRQKRMQRRKQRKQRRNPKQHRRRRGORKQKQRNRKQRQKQRR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask worldvein 58.0/100: 58% astral_power
Pre precombat 1 food worldvein 58.0/100: 58% astral_power
Pre precombat 2 augmentation worldvein 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H worldvein_resonance Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.249 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, lifeblood(3), battle_potion_of_intellect
0:02.211 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:03.144 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:04.077 default P stellar_flare Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:05.010 default I celestial_alignment Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:05.823 default F berserking Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:05.823 default G use_items Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:05.823 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse
0:06.579 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse
0:07.336 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(24), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.091 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(23), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.844 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(23), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.631 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(22), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse
0:10.385 default R solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(21), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.139 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(20), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.906 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(20), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.659 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(19), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.428 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(18), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.183 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(17), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.937 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(17), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.692 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(16), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.446 default N sunfire Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(15), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.200 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(14), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.955 default O moonfire Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(14), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.710 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(13), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.464 default Q lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(12), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.271 default R solar_wrath Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(11), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.025 default J cancel_buff Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(10), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.025 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, overwhelming_power(10), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.779 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(10), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.533 default K starsurge Fluffy_Pillow 61.0/100: 61% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(9), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.288 default P stellar_flare Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(8), lifeblood(4), ignition_mages_fuse(5)
0:24.042 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(7), lifeblood(4), ignition_mages_fuse(5)
0:24.796 default L sunfire Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(7), lifeblood(4), ignition_mages_fuse(5)
0:25.550 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(6), lifeblood(4), ignition_mages_fuse(5)
0:26.487 default K starsurge Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(5), lifeblood(4)
0:27.378 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(4), lifeblood(4)
0:28.485 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(3), lifeblood(4)
0:29.239 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(2), lifeblood(4)
0:30.353 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power, lifeblood(4)
0:31.472 default R solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4)
0:32.227 default Q lunar_strike Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4)
0:33.350 default R solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4)
0:34.104 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, lifeblood(4)
0:34.988 default R solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4)
0:35.743 default K starsurge Fluffy_Pillow 72.5/100: 73% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, lifeblood(4)
0:36.510 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4)
0:37.263 default Q lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4)
0:38.241 default R solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, lifeblood(4)
0:39.009 default Q lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, lifeblood(4)
0:39.986 default R solar_wrath Fluffy_Pillow 75.5/100: 76% astral_power bloodlust, arcanic_pulsar, celestial_alignment, starlord(3), torrent_of_elements, lifeblood(4)
0:40.755 default M moonfire Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, arcanic_pulsar, celestial_alignment, starlord(3), torrent_of_elements, lifeblood(4)
0:41.523 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar, torrent_of_elements, lifeblood(4)
0:42.771 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, lifeblood(4)
0:43.985 default N sunfire Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(4)
0:45.162 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(4)
0:46.662 default P stellar_flare Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(4)
0:47.840 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(4)
0:49.017 default R solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, lifeblood(4)
0:49.992 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4)
0:51.450 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4)
0:52.909 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), lifeblood(4)
0:54.055 default R solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), lifeblood(4)
0:55.028 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(4)
0:56.487 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(25), lifeblood(4)
0:57.378 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), lifeblood(4)
0:58.716 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(23), lifeblood(4)
0:59.611 default Q lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(22), lifeblood(4)
1:00.960 default H worldvein_resonance Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(21), lifeblood(4)
1:02.021 default K starsurge Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(5), solar_empowerment, overwhelming_power(19), lifeblood(4)
1:03.185 default N sunfire Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(18), lifeblood(4)
1:04.320 default O moonfire Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(17), lifeblood(4)
1:05.458 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(16), lifeblood(4)
1:06.602 default R solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(15), lifeblood(4)
1:07.550 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(14), lifeblood(4), conch_of_dark_whispers
1:08.974 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(25), lifeblood(4), conch_of_dark_whispers
1:10.346 default P stellar_flare Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power(23), lifeblood(4), conch_of_dark_whispers
1:11.430 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power(22), lifeblood(4), conch_of_dark_whispers
1:12.517 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(21), lifeblood(4), conch_of_dark_whispers
1:13.419 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20), lifeblood(4), conch_of_dark_whispers
1:14.778 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(19), lifeblood(4), conch_of_dark_whispers
1:15.687 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(18), lifeblood(4), conch_of_dark_whispers
1:16.599 default R solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(17), lifeblood(4), conch_of_dark_whispers
1:17.673 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(16), lifeblood(4), conch_of_dark_whispers
1:18.754 default R solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(15), lifeblood(4), conch_of_dark_whispers
1:19.837 default N sunfire Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(14), lifeblood(4), conch_of_dark_whispers
1:20.927 default R solar_wrath Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(13), lifeblood(4), conch_of_dark_whispers
1:22.019 default J cancel_buff Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(11), lifeblood(4)
1:22.019 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(8), torrent_of_elements, overwhelming_power(11), lifeblood(4)
1:23.217 default R solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(10), lifeblood(4)
1:24.082 default K starsurge Fluffy_Pillow 72.0/100: 72% astral_power celestial_alignment, lunar_empowerment, starlord, torrent_of_elements, overwhelming_power(9), lifeblood(4)
1:25.101 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(8), lifeblood(4)
1:25.947 default Q lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(8), lifeblood(4)
1:27.213 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(6), lifeblood(4)
1:28.215 default M moonfire Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(5), lifeblood(4)
1:29.193 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(4), lifeblood(4)
1:30.630 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(3), lifeblood(4)
1:32.072 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power, lifeblood(4)
1:33.212 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4)
1:34.672 default P stellar_flare Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4)
1:35.817 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4)
1:37.276 default N sunfire Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(3), lifeblood(4)
1:38.422 default R solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(3), lifeblood(4)
1:39.395 default R solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), lifeblood(4)
1:40.367 default R solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4)
1:41.339 default R solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, lifeblood(4)
1:42.487 default K starsurge Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(3), torrent_of_elements, lifeblood(4)
1:43.735 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, lifeblood(4)
1:44.948 default Q lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(4)
1:46.448 default O moonfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(4)
1:47.624 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(4)
1:49.125 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(4)
1:50.126 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), torrent_of_elements, lifeblood(4)
1:51.304 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4)
1:52.764 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4)
1:53.737 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4)
1:54.711 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(6), starlord(3), lifeblood(4)
1:55.857 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), lifeblood(4)
1:57.001 default N sunfire Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4)
1:58.147 default P stellar_flare Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4)
1:59.294 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4)
2:00.753 default H worldvein_resonance Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4)
2:02.105 default Q lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4)
2:03.564 default R solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(7), solar_empowerment(3), torrent_of_elements, lifeblood(4)
2:04.626 default K starsurge Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(7), solar_empowerment(2), torrent_of_elements, lifeblood(4)
2:05.874 default G use_items Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, lifeblood(4)
2:05.874 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, lifeblood(4), ignition_mages_fuse
2:06.863 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, lifeblood(4), ignition_mages_fuse
2:08.345 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord, torrent_of_elements, lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse
2:09.508 default O moonfire Fluffy_Pillow 30.0/100: 30% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse
2:10.493 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(2)
2:11.296 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(2)
2:12.241 default R solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(2)
2:13.023 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(2)
2:14.193 default L sunfire Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(3)
2:15.077 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(3)
2:16.374 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.392 default R solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(3)
2:18.255 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(4)
2:19.503 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(4)
2:20.751 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), lifeblood(3), conch_of_dark_whispers, ignition_mages_fuse(4)
2:21.583 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(3), conch_of_dark_whispers, ignition_mages_fuse(4)
2:22.831 default P stellar_flare Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), lifeblood(4), ignition_mages_fuse(5)
2:23.777 default R solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), lifeblood(4), ignition_mages_fuse(5)
2:24.578 default R solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), lifeblood(4), ignition_mages_fuse(5)
2:25.382 default K starsurge Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(2), lifeblood(4), ignition_mages_fuse(5)
2:26.413 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, lifeblood(4)
2:27.626 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), lifeblood(4)
2:29.126 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood(4)
2:30.627 default O moonfire Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(25), lifeblood(4)
2:31.704 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(24), lifeblood(4)
2:32.784 default N sunfire Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(23), lifeblood(4)
2:33.839 default R solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(22), lifeblood(4)
2:34.738 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), lifeblood(4)
2:36.091 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(19), lifeblood(4)
2:37.001 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(18), lifeblood(4)
2:38.075 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17), lifeblood(4)
2:39.446 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(16), lifeblood(4)
2:40.366 default R solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(15), lifeblood(4)
2:41.290 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(14), lifeblood(4)
2:42.379 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), overwhelming_power(13), lifeblood(4)
2:43.771 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(12), lifeblood(4)
2:44.703 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(11), lifeblood(4)
2:45.805 default K starsurge Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(6), lunar_empowerment, overwhelming_power(10), lifeblood(4)
2:47.007 default P stellar_flare Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(8), lifeblood(4)
2:48.182 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(7), lifeblood(4)
2:49.361 default N sunfire Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(6), lifeblood(4)
2:50.512 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(5), lifeblood(4)
2:51.986 default O moonfire Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(4), lifeblood(4)
2:53.147 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(2), lifeblood(4)
2:54.635 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power, lifeblood(4)
2:56.130 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), lifeblood(4)
2:57.307 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), lifeblood(4)
2:58.154 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4)
2:59.424 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power celestial_alignment, solar_empowerment(2), starlord(3), lifeblood(4)
3:00.421 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), lifeblood(4)
3:01.268 default H worldvein_resonance Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(4)
3:02.265 default L sunfire Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(4)
3:03.260 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(4)
3:04.719 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4)
3:06.178 default I celestial_alignment Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment(3), torrent_of_elements, lifeblood(4)
3:07.263 default E potion Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment(3), torrent_of_elements, lifeblood(4)
3:07.263 default F berserking Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment(3), torrent_of_elements, lifeblood(4), battle_potion_of_intellect
3:07.263 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power berserking, arcanic_pulsar, celestial_alignment, solar_empowerment(3), torrent_of_elements, lifeblood(4), battle_potion_of_intellect
3:08.251 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, lifeblood(4), battle_potion_of_intellect
3:09.066 default K starsurge Fluffy_Pillow 63.0/100: 63% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, lifeblood(4), battle_potion_of_intellect
3:10.025 default P stellar_flare Fluffy_Pillow 23.5/100: 24% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, lifeblood(4), battle_potion_of_intellect
3:10.960 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, lifeblood(4), battle_potion_of_intellect
3:11.753 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(4), battle_potion_of_intellect
3:12.941 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, lifeblood(4), battle_potion_of_intellect
3:13.734 default O moonfire Fluffy_Pillow 66.0/100: 66% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(4), battle_potion_of_intellect
3:14.666 default R solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(4), battle_potion_of_intellect
3:15.460 default K starsurge Fluffy_Pillow 78.0/100: 78% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, lifeblood(4), battle_potion_of_intellect
3:16.391 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4), battle_potion_of_intellect
3:17.162 default Q lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4), battle_potion_of_intellect
3:18.316 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4), battle_potion_of_intellect
3:19.222 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4), battle_potion_of_intellect
3:19.993 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4), battle_potion_of_intellect
3:21.263 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect
3:22.259 default N sunfire Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), lifeblood(3), battle_potion_of_intellect
3:23.254 default R solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), lifeblood(2), battle_potion_of_intellect
3:24.101 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), lifeblood(3), battle_potion_of_intellect
3:25.373 default M moonfire Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood(3), battle_potion_of_intellect
3:26.369 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect
3:27.829 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, lifeblood(3), battle_potion_of_intellect
3:29.078 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord, lifeblood(4), battle_potion_of_intellect
3:30.623 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, lifeblood(4), battle_potion_of_intellect
3:32.169 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord, lifeblood(4), battle_potion_of_intellect
3:33.198 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord, lifeblood(4)
3:34.410 default P stellar_flare Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(2), lifeblood(4)
3:35.589 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(2), lifeblood(4)
3:36.590 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood(4)
3:38.091 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), lifeblood(4)
3:39.269 default N sunfire Fluffy_Pillow 24.0/100: 24% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), lifeblood(4)
3:40.265 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), lifeblood(4)
3:41.112 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4)
3:42.383 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power celestial_alignment, solar_empowerment(2), starlord(3), lifeblood(4)
3:43.377 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), lifeblood(4)
3:44.225 default M moonfire Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4)
3:45.223 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4)
3:46.682 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers
3:47.656 default R solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar, solar_empowerment, starlord(3), lifeblood(4), conch_of_dark_whispers
3:48.629 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar, lifeblood(4), conch_of_dark_whispers
3:49.876 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, lifeblood(4), conch_of_dark_whispers
3:51.420 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord, lifeblood(4), conch_of_dark_whispers
3:52.450 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(2), solar_empowerment, starlord, lifeblood(4), conch_of_dark_whispers
3:53.662 default Q lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood(4), conch_of_dark_whispers
3:55.163 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(2), overwhelming_power(25), lifeblood(4), conch_of_dark_whispers
3:56.078 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), overwhelming_power(24), lifeblood(4), conch_of_dark_whispers
3:56.996 default N sunfire Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2), overwhelming_power(24), lifeblood(4), conch_of_dark_whispers
3:58.078 default P stellar_flare Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2), overwhelming_power(22), lifeblood(4), conch_of_dark_whispers
3:59.167 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2), overwhelming_power(21), lifeblood(4), conch_of_dark_whispers
4:00.258 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20), lifeblood(4), conch_of_dark_whispers
4:01.617 default H worldvein_resonance Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(19), lifeblood(4), conch_of_dark_whispers
4:02.687 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(18), lifeblood(4), conch_of_dark_whispers
4:03.598 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(17), lifeblood(4), conch_of_dark_whispers
4:04.511 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(16), lifeblood(4), conch_of_dark_whispers
4:05.591 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(15), lifeblood(4), conch_of_dark_whispers
4:06.677 default G use_items Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(14), lifeblood(4), conch_of_dark_whispers
4:06.677 default O moonfire Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(14), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse
4:07.724 default R solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(13), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse
4:08.774 default K starsurge Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(4), overwhelming_power(12), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse
4:09.921 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(11), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse
4:11.348 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(5), solar_empowerment, starlord, overwhelming_power(9), lifeblood(4), ignition_mages_fuse(2)
4:12.433 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(8), lifeblood(4), ignition_mages_fuse(2)
4:13.780 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(7), lifeblood(4), ignition_mages_fuse(2)
4:14.682 default N sunfire Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), overwhelming_power(6), lifeblood(4), ignition_mages_fuse(3)
4:15.706 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), overwhelming_power(5), lifeblood(4), ignition_mages_fuse(3)
4:16.582 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(6), starlord(2), overwhelming_power(4), lifeblood(4), ignition_mages_fuse(3)
4:17.614 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(3), lifeblood(4), ignition_mages_fuse(3)
4:18.896 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(2), lifeblood(4), ignition_mages_fuse(4)
4:19.725 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), overwhelming_power, lifeblood(4), ignition_mages_fuse(4)
4:20.969 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(7), starlord(3), lifeblood(4), ignition_mages_fuse(4)
4:21.948 default Q lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), lifeblood(4), ignition_mages_fuse(4)
4:23.196 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), lifeblood(4), ignition_mages_fuse(5)
4:23.999 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(8), starlord(3), lifeblood(4), ignition_mages_fuse(5)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="worldvein"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/thorns
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

Simulation & Raid Information

Iterations: 7606
Threads: 6
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 299.9 )

Performance:

Total Events Processed: 233600950
Max Event Queue: 429
Sim Seconds: 2281354
CPU Seconds: 474.7188
Physical Seconds: 140.7564
Speed Up: 4806

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
base base augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
base base berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.65sec 0 299.94sec
base base celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.62sec 0 299.94sec
base base flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
base base food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
base base heed_my_call 271685 87516 292 1.63 9106 18221 8.2 8.2 17.8% 0.0% 0.0% 0.0% 33.35sec 87516 299.94sec
base base heed_my_call_aoe 271686 37565 125 1.63 3902 7811 8.2 8.2 18.0% 0.0% 0.0% 0.0% 33.35sec 37565 299.94sec
base base lunar_strike 194153 1518798 5064 15.55 16571 33115 77.8 77.8 17.9% 0.0% 0.0% 0.0% 3.77sec 1518798 299.94sec
base base moonfire 8921 47373 158 2.81 2860 5719 14.1 14.1 17.8% 0.0% 0.0% 0.0% 21.40sec 735544 299.94sec
base base moonfire ticks -8921 688171 2294 44.37 2629 5256 14.1 221.9 18.0% 0.0% 0.0% 0.0% 21.40sec 735544 299.94sec
base base moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
base base potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
base base shooting_stars 202497 238036 794 8.84 4564 9121 44.2 44.2 18.0% 0.0% 0.0% 0.0% 6.67sec 238036 299.94sec
base base solar_wrath 190984 853573 2846 18.98 7633 15252 94.4 94.9 17.9% 0.0% 0.0% 0.0% 3.12sec 853573 299.94sec
base base solar_empowerment 279729 493302 1645 14.96 6596 0 74.8 74.8 0.0% 0.0% 0.0% 0.0% 3.93sec 493302 299.94sec
base base starsurge 78674 3564385 11884 12.29 49241 98386 61.6 61.4 17.9% 0.0% 0.0% 0.0% 4.92sec 3564385 299.94sec
base base stellar_flare 202347 36502 122 2.56 2424 4841 12.8 12.8 17.9% 0.0% 0.0% 0.0% 23.57sec 477572 299.94sec
base base stellar_flare ticks -202347 441070 1470 43.90 1704 3406 12.8 219.5 17.9% 0.0% 0.0% 0.0% 23.57sec 477572 299.94sec
base base streaking_stars 272873 1736309 5789 18.02 16348 32705 90.1 90.1 17.9% 0.0% 0.0% 0.0% 3.10sec 1736309 299.94sec
base base sunfire 93402 82509 275 3.57 3914 7825 17.9 17.9 18.0% 0.0% 0.0% 0.0% 16.77sec 818404 299.94sec
base base sunfire ticks -93402 735895 2453 44.19 2824 5646 17.9 221.0 17.9% 0.0% 0.0% 0.0% 16.77sec 818404 299.94sec
blood of the enemy blood of the enemy augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
blood of the enemy blood of the enemy berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.53sec 0 299.94sec
blood of the enemy blood of the enemy blood_of_the_enemy 297108 108627 362 0.74 22900 57311 3.7 3.7 19.2% 0.0% 0.0% 0.0% 91.18sec 108627 299.94sec
blood of the enemy blood of the enemy celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.66sec 0 299.94sec
blood of the enemy blood of the enemy flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
blood of the enemy blood of the enemy food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
blood of the enemy blood of the enemy heed_my_call 271685 92486 308 1.65 9105 18716 8.2 8.2 22.2% 0.0% 0.0% 0.0% 33.02sec 92486 299.94sec
blood of the enemy blood of the enemy heed_my_call_aoe 271686 39713 132 1.65 3903 8014 8.2 8.2 22.5% 0.0% 0.0% 0.0% 33.02sec 39713 299.94sec
blood of the enemy blood of the enemy lunar_strike 194153 1566067 5221 15.46 16500 33939 77.3 77.3 21.6% 0.0% 0.0% 0.0% 3.79sec 1566067 299.94sec
blood of the enemy blood of the enemy moonfire 8921 49446 165 2.81 2846 5929 14.1 14.1 21.8% 0.0% 0.0% 0.0% 21.40sec 779552 299.94sec
blood of the enemy blood of the enemy moonfire ticks -8921 730107 2434 44.77 2617 5511 14.1 223.9 22.3% 0.0% 0.0% 0.0% 21.40sec 779552 299.94sec
blood of the enemy blood of the enemy moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
blood of the enemy blood of the enemy potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
blood of the enemy blood of the enemy shooting_stars 202497 253114 844 8.95 4542 9544 44.8 44.8 22.3% 0.0% 0.0% 0.0% 6.55sec 253114 299.94sec
blood of the enemy blood of the enemy solar_wrath 190984 885175 2951 18.86 7589 15693 93.8 94.3 22.2% 0.0% 0.0% 0.0% 3.13sec 885175 299.94sec
blood of the enemy blood of the enemy solar_empowerment 279729 515602 1719 14.89 6925 0 74.5 74.5 0.0% 0.0% 0.0% 0.0% 3.93sec 515602 299.94sec
blood of the enemy blood of the enemy starsurge 78674 3758322 12530 12.24 48963 103750 61.4 61.2 22.7% 0.0% 0.0% 0.0% 4.92sec 3758322 299.94sec
blood of the enemy blood of the enemy stellar_flare 202347 38345 128 2.56 2409 5116 12.8 12.8 21.8% 0.0% 0.0% 0.0% 23.57sec 506950 299.94sec
blood of the enemy blood of the enemy stellar_flare ticks -202347 468605 1562 44.31 1696 3572 12.8 221.5 22.3% 0.0% 0.0% 0.0% 23.57sec 506950 299.94sec
blood of the enemy blood of the enemy streaking_stars 272873 1862400 6209 17.74 16354 34116 88.7 88.7 26.1% 0.0% 0.0% 0.0% 3.13sec 1862400 299.94sec
blood of the enemy blood of the enemy sunfire 93402 85348 285 3.58 3903 8027 17.9 17.9 21.1% 0.0% 0.0% 0.0% 16.73sec 866210 299.94sec
blood of the enemy blood of the enemy sunfire ticks -93402 780862 2603 44.61 2811 5904 17.9 223.0 22.3% 0.0% 0.0% 0.0% 16.73sec 866210 299.94sec
conflict+strife conflict+strife augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
conflict+strife conflict+strife berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.37sec 0 299.94sec
conflict+strife conflict+strife celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.27sec 0 299.94sec
conflict+strife conflict+strife flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
conflict+strife conflict+strife food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
conflict+strife conflict+strife heed_my_call 271685 90953 303 1.63 9459 18905 8.2 8.2 17.9% 0.0% 0.0% 0.0% 33.31sec 90953 299.94sec
conflict+strife conflict+strife heed_my_call_aoe 271686 38943 130 1.63 4053 8108 8.2 8.2 17.8% 0.0% 0.0% 0.0% 33.31sec 38943 299.94sec
conflict+strife conflict+strife lunar_strike 194153 1544946 5151 15.22 17224 34432 76.1 76.1 17.9% 0.0% 0.0% 0.0% 3.84sec 1544946 299.94sec
conflict+strife conflict+strife moonfire 8921 48941 163 2.81 2958 5921 14.0 14.0 17.8% 0.0% 0.0% 0.0% 21.36sec 759596 299.94sec
conflict+strife conflict+strife moonfire ticks -8921 710655 2369 44.19 2727 5450 14.0 221.0 18.0% 0.0% 0.0% 0.0% 21.36sec 759596 299.94sec
conflict+strife conflict+strife moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
conflict+strife conflict+strife potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
conflict+strife conflict+strife shooting_stars 202497 246218 821 8.83 4730 9460 44.1 44.1 18.0% 0.0% 0.0% 0.0% 6.60sec 246218 299.94sec
conflict+strife conflict+strife solar_wrath 190984 863045 2877 18.48 7925 15845 91.9 92.4 17.9% 0.0% 0.0% 0.0% 3.20sec 863045 299.94sec
conflict+strife conflict+strife solar_empowerment 279729 503220 1678 14.70 6847 0 73.5 73.5 0.0% 0.0% 0.0% 0.0% 3.99sec 503220 299.94sec
conflict+strife conflict+strife starsurge 78674 3639709 12135 12.08 51114 102130 60.6 60.4 18.0% 0.0% 0.0% 0.0% 4.99sec 3639709 299.94sec
conflict+strife conflict+strife stellar_flare 202347 37425 125 2.55 2490 4981 12.8 12.8 17.9% 0.0% 0.0% 0.0% 23.57sec 493202 299.94sec
conflict+strife conflict+strife stellar_flare ticks -202347 455778 1519 43.72 1768 3534 12.8 218.6 18.0% 0.0% 0.0% 0.0% 23.57sec 493202 299.94sec
conflict+strife conflict+strife streaking_stars 272873 1753108 5845 17.61 16899 33811 88.0 88.0 17.9% 0.0% 0.0% 0.0% 3.16sec 1753108 299.94sec
conflict+strife conflict+strife sunfire 93402 84830 283 3.55 4052 8100 17.7 17.7 18.0% 0.0% 0.0% 0.0% 16.82sec 845223 299.94sec
conflict+strife conflict+strife sunfire ticks -93402 760393 2535 44.03 2929 5854 17.7 220.2 17.9% 0.0% 0.0% 0.0% 16.82sec 845223 299.94sec
conflict+strife conflict+strife thorns 305497 1096717 3656 11.18 16646 33277 63.0 55.9 17.9% 0.0% 0.0% 0.0% 4.68sec 1096717 299.94sec
crucible of flame crucible of flame ancient_flame ticks -295367 377709 1259 17.99 3557 7117 24.9 90.0 18.0% 0.0% 0.0% 0.0% 11.73sec 377709 299.94sec
crucible of flame crucible of flame augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
crucible of flame crucible of flame berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.46sec 0 299.94sec
crucible of flame crucible of flame celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.48sec 0 299.94sec
crucible of flame crucible of flame concentrated_flame 295373 0 0 0.00 0 0 11.5 0.0 0.0% 0.0% 0.0% 0.0% 29.91sec 0 299.94sec
crucible of flame crucible of flame concentrated_flame_missile 295374 341276 1138 2.30 25165 50742 11.5 11.5 17.7% 0.0% 0.0% 0.0% 29.91sec 341276 299.94sec
crucible of flame crucible of flame concentrated_flame_burn ticks -295368 222224 741 6.41 6932 0 11.5 32.1 0.0% 0.0% 0.0% 0.0% 29.91sec 222224 299.94sec
crucible of flame crucible of flame flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
crucible of flame crucible of flame food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
crucible of flame crucible of flame heed_my_call 271685 87204 291 1.62 9113 18219 8.1 8.1 18.1% 0.0% 0.0% 0.0% 33.68sec 87204 299.94sec
crucible of flame crucible of flame heed_my_call_aoe 271686 37272 124 1.62 3905 7814 8.1 8.1 17.8% 0.0% 0.0% 0.0% 33.68sec 37272 299.94sec
crucible of flame crucible of flame lunar_strike 194153 1450446 4836 14.82 16599 33187 74.1 74.1 17.9% 0.0% 0.0% 0.0% 3.93sec 1450446 299.94sec
crucible of flame crucible of flame moonfire 8921 47240 157 2.81 2849 5700 14.1 14.1 17.9% 0.0% 0.0% 0.0% 21.26sec 728092 299.94sec
crucible of flame crucible of flame moonfire ticks -8921 680852 2270 43.96 2626 5248 14.1 219.8 18.0% 0.0% 0.0% 0.0% 21.26sec 728092 299.94sec
crucible of flame crucible of flame moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
crucible of flame crucible of flame potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
crucible of flame crucible of flame shooting_stars 202497 235653 786 8.77 4557 9111 43.8 43.8 18.0% 0.0% 0.0% 0.0% 6.62sec 235653 299.94sec
crucible of flame crucible of flame solar_wrath 190984 804976 2684 17.87 7645 15276 88.8 89.3 17.9% 0.0% 0.0% 0.0% 3.30sec 804976 299.94sec
crucible of flame crucible of flame solar_empowerment 279729 472650 1576 14.33 6599 0 71.6 71.6 0.0% 0.0% 0.0% 0.0% 4.07sec 472650 299.94sec
crucible of flame crucible of flame starsurge 78674 3428512 11431 11.81 49253 98428 59.3 59.1 17.9% 0.0% 0.0% 0.0% 5.07sec 3428512 299.94sec
crucible of flame crucible of flame stellar_flare 202347 35433 118 2.54 2369 4734 12.7 12.7 17.8% 0.0% 0.0% 0.0% 23.57sec 472054 299.94sec
crucible of flame crucible of flame stellar_flare ticks -202347 436621 1455 43.49 1702 3403 12.7 217.5 18.0% 0.0% 0.0% 0.0% 23.57sec 472054 299.94sec
crucible of flame crucible of flame streaking_stars 272873 1654952 5518 17.16 16359 32727 85.8 85.8 17.9% 0.0% 0.0% 0.0% 3.23sec 1654952 299.94sec
crucible of flame crucible of flame sunfire 93402 81613 272 3.54 3907 7806 17.7 17.7 18.0% 0.0% 0.0% 0.0% 16.77sec 810162 299.94sec
crucible of flame crucible of flame sunfire ticks -93402 728550 2428 43.79 2821 5637 17.7 219.0 18.0% 0.0% 0.0% 0.0% 16.77sec 810162 299.94sec
focusing iris focusing iris augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
focusing iris focusing iris berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.60sec 0 299.94sec
focusing iris focusing iris celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.41sec 0 299.94sec
focusing iris focusing iris flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
focusing iris focusing iris food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
focusing iris focusing iris heed_my_call 271685 91098 304 1.69 9107 18219 8.5 8.5 18.0% 0.0% 0.0% 0.0% 32.26sec 91098 299.94sec
focusing iris focusing iris heed_my_call_aoe 271686 38989 130 1.69 3903 7810 8.5 8.5 17.9% 0.0% 0.0% 0.0% 32.26sec 38989 299.94sec
focusing iris focusing iris lunar_strike 194153 1580803 5270 16.16 16589 33165 80.8 80.8 18.0% 0.0% 0.0% 0.0% 3.62sec 1580803 299.94sec
focusing iris focusing iris moonfire 8921 47603 159 2.83 2855 5703 14.2 14.2 17.8% 0.0% 0.0% 0.0% 21.34sec 763931 299.94sec
focusing iris focusing iris moonfire ticks -8921 716328 2388 46.17 2632 5262 14.2 230.9 17.9% 0.0% 0.0% 0.0% 21.34sec 763931 299.94sec
focusing iris focusing iris moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
focusing iris focusing iris potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
focusing iris focusing iris shooting_stars 202497 247809 826 9.20 4567 9126 46.0 46.0 18.0% 0.0% 0.0% 0.0% 6.34sec 247809 299.94sec
focusing iris focusing iris solar_wrath 190984 901717 3006 20.01 7643 15278 99.5 100.0 18.0% 0.0% 0.0% 0.0% 2.97sec 901717 299.94sec
focusing iris focusing iris solar_empowerment 279729 512941 1710 15.53 6609 0 77.6 77.6 0.0% 0.0% 0.0% 0.0% 3.78sec 512941 299.94sec
focusing iris focusing iris starsurge 78674 3693897 12315 12.72 49287 98451 63.8 63.6 17.9% 0.0% 0.0% 0.0% 4.74sec 3693897 299.94sec
focusing iris focusing iris stellar_flare 202347 36591 122 2.56 2428 4856 12.8 12.8 17.7% 0.0% 0.0% 0.0% 23.56sec 496343 299.94sec
focusing iris focusing iris stellar_flare ticks -202347 459753 1533 45.70 1706 3410 12.8 228.5 17.9% 0.0% 0.0% 0.0% 23.56sec 496343 299.94sec
focusing iris focusing iris streaking_stars 272873 1803476 6013 18.72 16350 32712 93.6 93.6 17.9% 0.0% 0.0% 0.0% 3.00sec 1803476 299.94sec
focusing iris focusing iris sunfire 93402 80960 270 3.51 3913 7818 17.6 17.6 17.9% 0.0% 0.0% 0.0% 17.08sec 848054 299.94sec
focusing iris focusing iris sunfire ticks -93402 767094 2557 46.02 2828 5649 17.6 230.1 17.9% 0.0% 0.0% 0.0% 17.08sec 848054 299.94sec
life-force life-force augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
life-force life-force azerite_spike 295835 222890 743 3.39 11156 22296 17.0 17.0 17.9% 0.0% 0.0% 0.0% 17.09sec 222890 299.94sec
life-force life-force berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.52sec 0 299.94sec
life-force life-force celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.40sec 0 299.94sec
life-force life-force flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
life-force life-force food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
life-force life-force guardian_of_azeroth 295840 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
life-force life-force heed_my_call 271685 91676 306 1.67 9326 18649 8.3 8.3 18.0% 0.0% 0.0% 0.0% 32.51sec 91676 299.94sec
life-force life-force heed_my_call_aoe 271686 39461 132 1.67 3997 7991 8.3 8.3 18.5% 0.0% 0.0% 0.0% 32.51sec 39461 299.94sec
life-force life-force lunar_strike 194153 1564546 5216 15.61 16993 33980 78.0 78.0 18.0% 0.0% 0.0% 0.0% 3.75sec 1564546 299.94sec
life-force life-force moonfire 8921 48256 161 2.81 2918 5848 14.0 14.0 17.8% 0.0% 0.0% 0.0% 21.38sec 769539 299.94sec
life-force life-force moonfire ticks -8921 721282 2404 45.21 2706 5408 14.0 226.0 18.0% 0.0% 0.0% 0.0% 21.38sec 769539 299.94sec
life-force life-force moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
life-force life-force potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
life-force life-force shooting_stars 202497 250163 834 9.04 4694 9381 45.2 45.2 18.0% 0.0% 0.0% 0.0% 6.45sec 250163 299.94sec
life-force life-force solar_wrath 190984 883147 2944 19.09 7851 15691 94.9 95.4 17.9% 0.0% 0.0% 0.0% 3.10sec 883147 299.94sec
life-force life-force solar_empowerment 279729 509347 1698 15.04 6775 0 75.2 75.2 0.0% 0.0% 0.0% 0.0% 3.89sec 509347 299.94sec
life-force life-force starsurge 78674 3679948 12269 12.35 50536 100989 61.9 61.7 18.0% 0.0% 0.0% 0.0% 4.87sec 3679948 299.94sec
life-force life-force stellar_flare 202347 37338 124 2.55 2488 4965 12.8 12.8 17.8% 0.0% 0.0% 0.0% 23.57sec 499647 299.94sec
life-force life-force stellar_flare ticks -202347 462309 1541 44.72 1753 3502 12.8 223.6 18.0% 0.0% 0.0% 0.0% 23.57sec 499647 299.94sec
life-force life-force streaking_stars 272873 1849995 6168 18.52 16956 33905 92.6 92.6 17.9% 0.0% 0.0% 0.0% 3.01sec 1849995 299.94sec
life-force life-force sunfire 93402 85205 284 3.59 4025 8044 18.0 18.0 17.9% 0.0% 0.0% 0.0% 16.61sec 857077 299.94sec
life-force life-force sunfire ticks -93402 771872 2573 45.03 2906 5808 18.0 225.2 18.0% 0.0% 0.0% 0.0% 16.61sec 857077 299.94sec
life-force life-force_guardian_of_azeroth azerite_spike 295856 474219 7904 58.22 6927 13853 58.2 58.2 17.6% 0.0% 0.0% 0.0% 3.64sec 474219 60.00sec
life-force life-force_guardian_of_azeroth azerite_volley 303351 61107 1018 6.00 8658 17316 6.0 6.0 17.6% 0.0% 0.0% 0.0% 39.28sec 61107 60.00sec
lucid dreams lucid dreams augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
lucid dreams lucid dreams berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.98sec 0 299.94sec
lucid dreams lucid dreams celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.01sec 0 299.94sec
lucid dreams lucid dreams flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
lucid dreams lucid dreams food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
lucid dreams lucid dreams heed_my_call 271685 89158 297 1.64 9201 18402 8.2 8.2 18.1% 0.0% 0.0% 0.0% 33.10sec 89158 299.94sec
lucid dreams lucid dreams heed_my_call_aoe 271686 38170 127 1.64 3943 7885 8.2 8.2 18.0% 0.0% 0.0% 0.0% 33.10sec 38170 299.94sec
lucid dreams lucid dreams lunar_strike 194153 1505368 5019 15.25 16750 33481 76.2 76.2 17.9% 0.0% 0.0% 0.0% 3.83sec 1505368 299.94sec
lucid dreams lucid dreams memory_of_lucid_dreams 298357 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 123.00sec 0 299.94sec
lucid dreams lucid dreams moonfire 8921 47795 159 2.83 2860 5723 14.2 14.2 17.9% 0.0% 0.0% 0.0% 21.27sec 747310 299.94sec
lucid dreams lucid dreams moonfire ticks -8921 699514 2332 44.49 2667 5329 14.2 222.4 17.9% 0.0% 0.0% 0.0% 21.27sec 747310 299.94sec
lucid dreams lucid dreams moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
lucid dreams lucid dreams potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
lucid dreams lucid dreams shooting_stars 202497 242648 809 8.89 4628 9258 44.4 44.4 18.0% 0.0% 0.0% 0.0% 6.56sec 242648 299.94sec
lucid dreams lucid dreams solar_wrath 190984 776627 2589 16.97 7758 15519 84.2 84.9 18.0% 0.0% 0.0% 0.0% 3.48sec 776627 299.94sec
lucid dreams lucid dreams solar_empowerment 279729 537676 1793 16.05 6701 0 80.2 80.2 0.0% 0.0% 0.0% 0.0% 3.64sec 537676 299.94sec
lucid dreams lucid dreams starsurge 78674 4237020 14126 14.39 49993 99864 72.2 71.9 17.9% 0.0% 0.0% 0.0% 4.20sec 4237020 299.94sec
lucid dreams lucid dreams stellar_flare 202347 36789 123 2.56 2447 4889 12.8 12.8 17.7% 0.0% 0.0% 0.0% 23.58sec 486071 299.94sec
lucid dreams lucid dreams stellar_flare ticks -202347 449281 1498 44.04 1729 3456 12.8 220.2 18.0% 0.0% 0.0% 0.0% 23.58sec 486071 299.94sec
lucid dreams lucid dreams streaking_stars 272873 1890567 6303 19.37 16560 33119 96.8 96.8 17.9% 0.0% 0.0% 0.0% 2.91sec 1890567 299.94sec
lucid dreams lucid dreams sunfire 93402 81790 273 3.49 3970 7947 17.4 17.4 18.0% 0.0% 0.0% 0.0% 17.16sec 829630 299.94sec
lucid dreams lucid dreams sunfire ticks -93402 747839 2493 44.31 2863 5723 17.4 221.6 17.9% 0.0% 0.0% 0.0% 17.16sec 829630 299.94sec
purification protocol purification protocol augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
purification protocol purification protocol berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.48sec 0 299.94sec
purification protocol purification protocol celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.16sec 0 299.94sec
purification protocol purification protocol flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
purification protocol purification protocol food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
purification protocol purification protocol heed_my_call 271685 87497 292 1.63 9106 18224 8.1 8.1 18.0% 0.0% 0.0% 0.0% 33.47sec 87497 299.94sec
purification protocol purification protocol heed_my_call_aoe 271686 37503 125 1.63 3903 7805 8.1 8.1 18.1% 0.0% 0.0% 0.0% 33.47sec 37503 299.94sec
purification protocol purification protocol lunar_strike 194153 1488250 4962 15.22 16596 33162 76.1 76.1 17.9% 0.0% 0.0% 0.0% 3.85sec 1488250 299.94sec
purification protocol purification protocol moonfire 8921 47474 158 2.82 2855 5709 14.1 14.1 18.1% 0.0% 0.0% 0.0% 21.31sec 731425 299.94sec
purification protocol purification protocol moonfire ticks -8921 683950 2280 44.15 2628 5253 14.1 220.8 17.9% 0.0% 0.0% 0.0% 21.31sec 731425 299.94sec
purification protocol purification protocol moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
purification protocol purification protocol potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
purification protocol purification protocol purification_protocol 295293 181165 604 3.30 9292 18589 16.5 16.5 18.0% 0.0% 0.0% 0.0% 17.42sec 181165 299.94sec
purification protocol purification protocol purifying_blast 295337 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 60.37sec 0 299.94sec
purification protocol purification protocol purifying_tick ticks -295338 202222 674 0.00 4532 9067 38.0 0.0 17.6% 0.0% 0.0% 0.0% 7.64sec 202222 299.94sec
purification protocol purification protocol shooting_stars 202497 236845 790 8.80 4560 9121 44.0 44.0 18.0% 0.0% 0.0% 0.0% 6.64sec 236845 299.94sec
purification protocol purification protocol solar_wrath 190984 827979 2760 18.39 7642 15269 91.4 91.9 17.9% 0.0% 0.0% 0.0% 3.21sec 827979 299.94sec
purification protocol purification protocol solar_empowerment 279729 483576 1612 14.67 6594 0 73.3 73.3 0.0% 0.0% 0.0% 0.0% 3.99sec 483576 299.94sec
purification protocol purification protocol starsurge 78674 3496930 11659 12.05 49248 98425 60.4 60.3 17.9% 0.0% 0.0% 0.0% 4.99sec 3496930 299.94sec
purification protocol purification protocol stellar_flare 202347 36047 120 2.55 2395 4796 12.7 12.7 18.0% 0.0% 0.0% 0.0% 23.57sec 474765 299.94sec
purification protocol purification protocol stellar_flare ticks -202347 438718 1462 43.69 1703 3404 12.7 218.4 18.0% 0.0% 0.0% 0.0% 23.57sec 474765 299.94sec
purification protocol purification protocol streaking_stars 272873 1711518 5706 17.75 16351 32709 88.7 88.7 18.0% 0.0% 0.0% 0.0% 3.13sec 1711518 299.94sec
purification protocol purification protocol sunfire 93402 82894 276 3.59 3914 7827 18.0 18.0 18.0% 0.0% 0.0% 0.0% 16.60sec 814791 299.94sec
purification protocol purification protocol sunfire ticks -93402 731897 2440 43.98 2823 5641 18.0 219.9 17.9% 0.0% 0.0% 0.0% 16.60sec 814791 299.94sec
ripple in space ripple in space augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
ripple in space ripple in space berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.47sec 0 299.94sec
ripple in space ripple in space celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.10sec 0 299.94sec
ripple in space ripple in space flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
ripple in space ripple in space food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
ripple in space ripple in space heed_my_call 271685 87461 292 1.63 9109 18215 8.1 8.1 17.8% 0.0% 0.0% 0.0% 33.30sec 87461 299.94sec
ripple in space ripple in space heed_my_call_aoe 271686 37555 125 1.63 3904 7803 8.1 8.1 18.1% 0.0% 0.0% 0.0% 33.30sec 37555 299.94sec
ripple in space ripple in space lunar_strike 194153 1550133 5168 15.21 17276 34541 76.1 76.1 18.0% 0.0% 0.0% 0.0% 3.84sec 1550133 299.94sec
ripple in space ripple in space moonfire 8921 49401 165 2.82 2981 5953 14.1 14.1 17.7% 0.0% 0.0% 0.0% 21.31sec 762243 299.94sec
ripple in space ripple in space moonfire ticks -8921 712842 2376 44.16 2738 5469 14.1 220.8 18.0% 0.0% 0.0% 0.0% 21.31sec 762243 299.94sec
ripple in space ripple in space moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
ripple in space ripple in space potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
ripple in space ripple in space ripple_in_space 302731 103962 347 1.09 19114 0 5.5 5.4 0.0% 0.0% 0.0% 0.0% 60.36sec 103962 299.94sec
ripple in space ripple in space shooting_stars 202497 246652 822 8.80 4750 9499 44.0 44.0 18.0% 0.0% 0.0% 0.0% 6.63sec 246652 299.94sec
ripple in space ripple in space solar_wrath 190984 863572 2879 18.40 7962 15920 91.4 92.0 17.9% 0.0% 0.0% 0.0% 3.22sec 863572 299.94sec
ripple in space ripple in space solar_empowerment 279729 504100 1681 14.67 6873 0 73.3 73.3 0.0% 0.0% 0.0% 0.0% 3.99sec 504100 299.94sec
ripple in space ripple in space starsurge 78674 3630238 12103 12.05 51095 102092 60.5 60.3 17.9% 0.0% 0.0% 0.0% 4.99sec 3630238 299.94sec
ripple in space ripple in space stellar_flare 202347 37453 125 2.55 2492 4981 12.7 12.7 18.0% 0.0% 0.0% 0.0% 23.57sec 494456 299.94sec
ripple in space ripple in space stellar_flare ticks -202347 457004 1523 43.69 1774 3544 12.7 218.4 18.0% 0.0% 0.0% 0.0% 23.57sec 494456 299.94sec
ripple in space ripple in space streaking_stars 272873 1711491 5706 17.75 16355 32723 88.7 88.7 17.9% 0.0% 0.0% 0.0% 3.12sec 1711491 299.94sec
ripple in space ripple in space sunfire 93402 86353 288 3.59 4081 8164 18.0 18.0 17.8% 0.0% 0.0% 0.0% 16.59sec 848844 299.94sec
ripple in space ripple in space sunfire ticks -93402 762490 2542 43.99 2940 5876 18.0 220.0 17.9% 0.0% 0.0% 0.0% 16.59sec 848844 299.94sec
unbound force unbound force augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
unbound force unbound force berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.34sec 0 299.94sec
unbound force unbound force celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.05sec 0 299.94sec
unbound force unbound force flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
unbound force unbound force food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
unbound force unbound force heed_my_call 271685 90032 300 1.62 9109 18225 8.1 8.1 22.0% 0.0% 0.0% 0.0% 33.63sec 90032 299.94sec
unbound force unbound force heed_my_call_aoe 271686 38626 129 1.62 3904 7809 8.1 8.1 22.1% 0.0% 0.0% 0.0% 33.63sec 38626 299.94sec
unbound force unbound force lunar_strike 194153 1521184 5072 15.24 16591 33092 76.2 76.2 20.4% 0.0% 0.0% 0.0% 3.84sec 1521184 299.94sec
unbound force unbound force moonfire 8921 48829 163 2.81 2857 5687 14.1 14.1 21.8% 0.0% 0.0% 0.0% 21.33sec 753765 299.94sec
unbound force unbound force moonfire ticks -8921 704937 2350 44.17 2631 5239 14.1 220.8 21.5% 0.0% 0.0% 0.0% 21.33sec 753765 299.94sec
unbound force unbound force moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
unbound force unbound force potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
unbound force unbound force shooting_stars 202497 245085 817 8.82 4564 9087 44.1 44.1 21.9% 0.0% 0.0% 0.0% 6.63sec 245085 299.94sec
unbound force unbound force solar_wrath 190984 848554 2829 18.48 7641 15247 91.8 92.4 20.3% 0.0% 0.0% 0.0% 3.20sec 848554 299.94sec
unbound force unbound force solar_empowerment 279729 494582 1649 14.69 6735 0 73.4 73.4 0.0% 0.0% 0.0% 0.0% 3.99sec 494582 299.94sec
unbound force unbound force starsurge 78674 3595019 11986 12.08 49277 98239 60.6 60.4 20.9% 0.0% 0.0% 0.0% 4.98sec 3595019 299.94sec
unbound force unbound force stellar_flare 202347 37007 123 2.55 2401 4792 12.7 12.7 21.1% 0.0% 0.0% 0.0% 23.57sec 488995 299.94sec
unbound force unbound force stellar_flare ticks -202347 451988 1507 43.70 1705 3396 12.7 218.5 21.5% 0.0% 0.0% 0.0% 23.57sec 488995 299.94sec
unbound force unbound force streaking_stars 272873 1732321 5776 17.65 16356 32714 88.2 88.2 20.0% 0.0% 0.0% 0.0% 3.14sec 1732321 299.94sec
unbound force unbound force sunfire 93402 85561 285 3.59 3918 7808 18.0 18.0 21.7% 0.0% 0.0% 0.0% 16.60sec 839554 299.94sec
unbound force unbound force sunfire ticks -93402 753993 2513 44.00 2825 5628 18.0 220.0 21.5% 0.0% 0.0% 0.0% 16.60sec 839554 299.94sec
unbound force unbound force the_unbound_force ticks -298452 333772 1113 7.92 1322 6795 5.0 39.6 76.5% 0.0% 0.0% 0.0% 67.13sec 333772 299.94sec
visions visions augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
visions visions berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 188.47sec 0 299.94sec
visions visions celestial_alignment 194223 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 154.46sec 0 299.94sec
visions visions flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
visions visions food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
visions visions heed_my_call 271685 90379 301 1.67 9197 18395 8.3 8.3 18.1% 0.0% 0.0% 0.0% 32.86sec 90379 299.94sec
visions visions heed_my_call_aoe 271686 38647 129 1.67 3941 7888 8.3 8.3 17.8% 0.0% 0.0% 0.0% 32.86sec 38647 299.94sec
visions visions lunar_strike 194153 1584411 5282 15.80 17005 33998 79.0 79.0 18.0% 0.0% 0.0% 0.0% 3.71sec 1584411 299.94sec
visions visions moonfire 8921 48942 163 2.85 2907 5811 14.3 14.3 18.0% 0.0% 0.0% 0.0% 21.20sec 768876 299.94sec
visions visions moonfire ticks -8921 719934 2400 45.14 2706 5404 14.3 225.7 17.9% 0.0% 0.0% 0.0% 21.20sec 768876 299.94sec
visions visions moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
visions visions potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
visions visions shooting_stars 202497 249363 831 9.01 4696 9384 45.0 45.0 17.9% 0.0% 0.0% 0.0% 6.49sec 249363 299.94sec
visions visions solar_wrath 190984 883520 2946 19.01 7884 15767 94.5 95.0 17.9% 0.0% 0.0% 0.0% 3.12sec 883520 299.94sec
visions visions solar_empowerment 279729 527707 1759 15.51 6805 0 77.5 77.5 0.0% 0.0% 0.0% 0.0% 3.79sec 527707 299.94sec
visions visions starsurge 78674 3822592 12744 12.79 50721 101378 64.2 63.9 17.9% 0.0% 0.0% 0.0% 4.72sec 3822592 299.94sec
visions visions stellar_flare 202347 37261 124 2.56 2475 4949 12.8 12.8 17.8% 0.0% 0.0% 0.0% 23.57sec 498820 299.94sec
visions visions stellar_flare ticks -202347 461560 1539 44.66 1753 3504 12.8 223.3 17.9% 0.0% 0.0% 0.0% 23.57sec 498820 299.94sec
visions visions streaking_stars 272873 2556957 8525 26.26 16516 33035 131.3 131.3 17.9% 0.0% 0.0% 0.0% 2.20sec 2556957 299.94sec
visions visions sunfire 93402 85215 284 3.60 4020 8039 18.0 18.0 17.8% 0.0% 0.0% 0.0% 16.68sec 855294 299.94sec
visions visions sunfire ticks -93402 770079 2567 44.97 2906 5808 18.0 224.8 17.9% 0.0% 0.0% 0.0% 16.68sec 855294 299.94sec
worldvein worldvein augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
worldvein worldvein berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.38sec 0 299.94sec
worldvein worldvein celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.16sec 0 299.94sec
worldvein worldvein flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
worldvein worldvein food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
worldvein worldvein heed_my_call 271685 87884 293 1.64 9107 18215 8.2 8.2 18.0% 0.0% 0.0% 0.0% 33.33sec 87884 299.94sec
worldvein worldvein heed_my_call_aoe 271686 37667 126 1.64 3903 7804 8.2 8.2 18.0% 0.0% 0.0% 0.0% 33.33sec 37667 299.94sec
worldvein worldvein lunar_strike 194153 1596441 5323 15.20 17799 35578 76.0 76.0 18.0% 0.0% 0.0% 0.0% 3.85sec 1596441 299.94sec
worldvein worldvein moonfire 8921 50750 169 2.82 3058 6115 14.1 14.1 17.8% 0.0% 0.0% 0.0% 21.30sec 784436 299.94sec
worldvein worldvein moonfire ticks -8921 733686 2446 44.15 2818 5631 14.1 220.8 18.0% 0.0% 0.0% 0.0% 21.30sec 784436 299.94sec
worldvein worldvein moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
worldvein worldvein potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
worldvein worldvein shooting_stars 202497 253203 844 8.78 4890 9772 43.9 43.9 18.0% 0.0% 0.0% 0.0% 6.64sec 253203 299.94sec
worldvein worldvein solar_wrath 190984 887925 2960 18.40 8189 16365 91.5 92.0 17.9% 0.0% 0.0% 0.0% 3.21sec 887925 299.94sec
worldvein worldvein solar_empowerment 279729 518450 1729 14.66 7073 0 73.3 73.3 0.0% 0.0% 0.0% 0.0% 3.99sec 518450 299.94sec
worldvein worldvein starsurge 78674 3729074 12433 12.05 52483 104887 60.4 60.2 18.0% 0.0% 0.0% 0.0% 4.99sec 3729074 299.94sec
worldvein worldvein stellar_flare 202347 38535 128 2.55 2567 5128 12.7 12.7 17.8% 0.0% 0.0% 0.0% 23.57sec 509050 299.94sec
worldvein worldvein stellar_flare ticks -202347 470515 1568 43.68 1826 3651 12.7 218.4 18.0% 0.0% 0.0% 0.0% 23.57sec 509050 299.94sec
worldvein worldvein streaking_stars 272873 1710785 5704 17.75 16354 32711 88.7 88.7 17.9% 0.0% 0.0% 0.0% 3.13sec 1710785 299.94sec
worldvein worldvein sunfire 93402 88673 296 3.59 4194 8395 17.9 17.9 17.8% 0.0% 0.0% 0.0% 16.61sec 873662 299.94sec
worldvein worldvein sunfire ticks -93402 784988 2617 43.98 3027 6048 17.9 219.9 18.0% 0.0% 0.0% 0.0% 16.61sec 873662 299.94sec
worldvein worldvein worldvein_resonance 295186 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 60.37sec 0 299.94sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
420794.2 0.0 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 13.18% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (0 - 10)_1:13.18%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 8.68% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.68%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 9.40% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (20 - 30)_1:9.40%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 9.11% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (30 - 40)_1:9.11%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.50% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.50%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 12.02% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (50 - 60)_1:12.02%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 12.33% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (60 - 70)_1:12.33%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.86% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.86%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 6.85% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (80 - 90)_1:6.85%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.07% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.07%

Trigger Attempt Success

  • trigger_pct:100.00%
Blood of the Enemy 2.0 0.0 182.9sec 182.9sec 6.76% 9.11% 0.0(0.0) 2.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_blood_of_the_enemy
  • max_stacks:1
  • duration:10.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • blood_of_the_enemy_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297108
  • name:Blood of the Enemy
  • tooltip:You have a $w2% increased chance to be Critically Hit by the caster.
  • description:The Heart of Azeroth erupts violently, dealing $s1 Shadow damage to enemies within $A1 yds. You gain $m2% critical strike chance against the targets for {$d=10 seconds}$?a297122[, and increases your critical hit damage by $297126m% for {$297126d=5 seconds}][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Condensed Life-Force (condensed_life_force) 10.8 64.3 28.5sec 3.8sec 43.98% 0.00% 64.3(64.3) 10.6

Buff details

  • buff initial source:life-force
  • cooldown name:buff_condensed_life_force
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • condensed_life_force_1:43.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295838
  • name:Condensed Life-Force
  • tooltip:Damage taken increased by $s1%.
  • description:{$@spelldesc295837=When an Azerite spike deals damage, all damage you deal against that target is increased by $295838s1% for {$295838d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bleeding_1:100.00%
Chaos Brand

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • chaos_brand_1:100.00%

Spelldata details

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mystic_touch_1:100.00%

Spelldata details

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 420794.22
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 7600
Mean 299.94
Minimum 240.00
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 7600
Mean 448945.99
Minimum 426878.04
Maximum 480733.53
Spread ( max - min ) 53855.49
Range [ ( max - min ) / 2 * 100% ] 6.00%
Standard Deviation 9174.5322
5th Percentile 434978.01
95th Percentile 463951.87
( 95th Percentile - 5th Percentile ) 28973.86
Mean Distribution
Standard Deviation 105.2391
95.00% Confidence Intervall ( 448739.72 - 449152.25 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1605
0.1 Scale Factor Error with Delta=300 718541
0.05 Scale Factor Error with Delta=300 2874164
0.01 Scale Factor Error with Delta=300 71854096
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 7600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 2447
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (123) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 136273078 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 2700 2700 2700
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=123
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

\n\n